Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04550-AT2G33310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AUX/IAA transcriptional regulator family protein
Function (paralog2):auxin-induced protein 13

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.20285910630465
Log2 mRNA fold difference:0.5126388401009
Log2 TE fold difference:-0.53944447588953
Sequences
Protein sequence

MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQ
GASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPK
VQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGS
SDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV

MITELEMGKGESELELGLGLSLGGGTAAKIGKSGGGGAWGERGRLLTAKDFPSVGSKRAA
DSASHAGSSPPRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVT
KKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVGLTSQFTK
PLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQEPNE
RQRKQPV

Other information
Ka divergence:-0.364628KaKs divergence:-0.00625
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):720Length 2 (bp):744Length divergence:0.016
MFE 1 (kcal):-219.8MFE 2 (kcal):-218.12MFE divergence-0.004