Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04630-AT2G33220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRIM-19 protein
Function (paralog2):GRIM-19 protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.85741786277919
Log2 mRNA fold difference:1.2218840789047
Log2 TE fold difference:-0.5281452029596
Sequences
Protein sequence

MTEAMIRNKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAMFLAVSGAFAWG
MYQVGQGNKIRRALKEEKYAARRTILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV
GENVYNSGRWMPPATGELRPDVW

MTEAMIRKKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAIFLTVSGAFAWG
MYQVGQGNKIRRALKEEKYAARRAILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV
GENVYNSGRWMPPATGELRPDVW

Other information
Ka divergence:0.00860585KaKs divergence:-0.158974
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):432Length 2 (bp):432Length divergence:0
MFE 1 (kcal):-140.56MFE 2 (kcal):-151.4MFE divergence0.037