Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04710-AT2G33150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):peroxisomal 3-ketoacyl-CoA thiolase 4
Function (paralog2):peroxisomal 3-ketoacyl-CoA thiolase 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.980725432693
Log2 mRNA fold difference:3.2770559951883
Log2 TE fold difference:-0.26200685306595
Sequences
Protein sequence

MEKATERQRILLRHLQPSSSSDASLSASACLSKDSAAYQYGDDVVIVAAQRTALCKAKRG
SFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPET
VPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNPNVKKFEQ
AHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPVKTKIVDP
KTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNV
AMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQF
VYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGS
GMGAAAVFERGGGVDELCDVRKV

MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRT
PLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAA
FYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVN
PAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIP
VKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGA
VLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEI
NEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFG
VVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR

www.000webhost.com

Other information
Ka divergence:-0.59766KaKs divergence:-0.536866
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1332Length 2 (bp):1389Length divergence:0.021
MFE 1 (kcal):-450.74MFE 2 (kcal):-507MFE divergence0.059