Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04750-AT1G04760
Species:Arabidopsis
Duplication type:TD
Function (paralog1):vesicle-associated membrane protein 721
Function (paralog2):vesicle-associated membrane protein 726

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.8457541258831
Log2 mRNA fold difference:-4.8443333182889
Log2 TE fold difference:-0.1120550234751
Sequences
Protein sequence

MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVE
DGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQY
CMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTG
TQMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC

MGQQSLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLAD
NGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQY
CADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQG
TKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKCT

Other information
Ka divergence:0.12652KaKs divergence:0.191209
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):660Length 2 (bp):663Length divergence:0.002
MFE 1 (kcal):-194.7MFE 2 (kcal):-188.11MFE divergence-0.017