Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04750-AT2G33120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vesicle-associated membrane protein 721
Function (paralog2):synaptobrevin-related protein 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.4591424038436
Log2 mRNA fold difference:0.045564673607448
Log2 TE fold difference:0.39549168543179
Sequences
Protein sequence

MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVE
DGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQY
CMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTG
TQMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC

MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVE
NGFSESKYCSISYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGS
KLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQ
AQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK

Other information
Ka divergence:0.291133KaKs divergence:-0.507217
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):660Length 2 (bp):690Length divergence:0.022
MFE 1 (kcal):-194.7MFE 2 (kcal):-180.45MFE divergence-0.038