Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04760-AT2G32670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vesicle-associated membrane protein 726
Function (paralog2):vesicle-associated membrane protein 725

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.58393164850897
Log2 mRNA fold difference:0.016023630315317
Log2 TE fold difference:1.327108762211
Sequences
Protein sequence

MGQQSLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLAD
NGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQY
CADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQG
TKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKCT

MDRSVVPISLAPFQFLLVFWIFLTSVHTNPNKQQKTVVSLSLWWNSKNRIRGCVWFFFLL
RVTRTMGQQNLIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTF
NYLVENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLK
EHMQYCVDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQD
FRTQGTKIRRKMWFENMKIKLIVLGIIITLILIIILSVCGGFKCT

Other information
Ka divergence:-0.136523KaKs divergence:-0.566935
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):663Length 2 (bp):858Length divergence:0.128
MFE 1 (kcal):-188.11MFE 2 (kcal):-240.7MFE divergence0.123