Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04810-AT2G32730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):26S proteasome regulatory complex, non-ATPase subcomplex, Rpn2/Psmd1 subunit
Function (paralog2):26S proteasome regulatory complex, non-ATPase subcomplex, Rpn2/Psmd1 subunit

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5830703051963
Log2 mRNA fold difference:1.534572139991
Log2 TE fold difference:0.085013756443587
Sequences
Protein sequence

MAAAMVSSAGGLLAMLNEPHPSLKLHALSYLIRLVDQFWPEISTSVPIIESLYEDEEFDQ
HQRQLAALLASKVFYYLGELNDSLSYALGAGSLFDVSEDSDYIHTLLSKAIDEYAILRSK
AVESSEVVEIDPRLVAIVERMLDKCITDGKYQQAMGIAIECRRLDKLEEAIIKSENVQGT
LSYCINVSHSFVNQREYRHEVLRLLVNVYQKLASPDYLSICQCLMFLDEPQGVASILEKL
LRSENKDDALLAFQISFDLVQNEHQAFLMSVRDRLPAPKTRPVEAIQAVETSTAQNENTA
GDVQMADETPSQTIVHETDPVDAVYAERLTKAKGILSGETSIQLTLQFLYSHNKSDLLIL
KTIKQSVEMRNSVCHSATIYANAIMHAGTTVDTFLRENLDWLSRATNWAKFSATAGLGVI
HRGHLQQGRSLMAPYLPQGGAGGGGSPYSEGGALYALGLIHANHGEGIKQFLRDSLRSTS
VEVIQHGACLGLGLAALGTADEDIYDDIKSVLYTDSAVAGEAAGISMGLLLVGTATDKAS
EMLAYAHETQHEKIIRGLALGIALTVYGREEGADTLIEQMTRDQDPIIRYGGMYALALAY
SGTANNKAIRQLLHFAVSDVSDDVRRTAVLALGFVLYSDPEQTPRIVSLLSESYNPHVRY
GAALAVGISCAGTGLSEAISLLEPLTSDVVDFVRQGALIAMAMVMVQISEASDSRVGAFR
RQLEKIILDKHEDTMSKMGAILASGILDAGGRNVTIRLLSKTKHDKVTAVIGLTVFSQFW
YWYPLIYFISLAFSPTAFIGLNYDLKVPKFEFMSHAKPSLFEYPKPTTVATANTAAKLPT
AVLSTSAKAKAKAKKEAEQKAKAENSGNEAGKANAASDEKEAESMQVDSTATTVEKKVEP
EATFEILVNPARVVPSQEKYIKLMEDSRYVPMKLAPSGFVLLRDLRPHEPEVLSLTDAPT
STASPAVGAEAAGQAQQAATTSAMAIDDEPQPPQAFEYASP

MATPMVSSAGGLLAMLNEPHPVLKLHALSNLNNLVDQFWPEISTSVPIIESLYEDEEFDL
HQRQLAALLVSKVFYYLGELNDSLSYALGAGPLFDVSEDSDYVHTLLAKAIDEYASLRSK
AVESNEMVDIDPRLEAIVERMLGKCISDGKYQQAMGIAIECRRLDKLEEAIIKSDNVQGT
LSYCINVSHSFVNRREYRHEVLSLLVKVYQKLPSPDYLSICQCLMFLDEPQGVASILEKL
LRSENKDDALLALQIAFDLVENEHQAFLLSVRDRLPAPKTRAVEATQAVETTIAPNENPS
GDVQMADETPAQTIVHETDPVDATYAERLTKIKGILSGETSIQLTLQFLYSHNKSDLLIL
KTIKQSVEMRNSVCHSATIYANAIMHAGTTVDTFLRENLDWLSRATNWAKFSATAGLGVI
HRGHLQQGRSLMAPYLPQGGAGGGGSPYSEGGALYALGLIHANHGEGIKQFLRDSLRSTN
VEVIQHGACLGLGLSALGTADEEIYDDVKSVLYTDSAVAGEAAGISMGLLLVGTATEKAS
EMLAYAHETQHEKIIRGLALGIALTVYGREEGADTLIEQMTRDQDPIIRYGGMYALALAY
SGTANNKAIRQLLHFAVSDVSDDVRRTAVLALGFVLYSDPEQTPRIVSLLSESYNPHVRY
GAALAVGISCAGTGLSEAISLLEPLTSDVVDFVRQGALIAMAMVMVQISEASDSRVGVFR
RQLEKIILDKHEDTMSKMGAILASGILDAGGRNVTIRLLSKTKHDKVTAVIGLAVFSQFW
YWYPLIYFISLAFSPTAFIGLNYDLKVPKFEFMSHAKPSLFEYPKPTTVPTANTAVKLPT
AVLSTSVKAKARAKKEAEQKAIAEKTSGPEKPVNESGSGKGKASTEKEGDSMQVDSPAAV
EKKAPEPEPAFEILVNPARVVPAQEKYIKLLDDSRYVPVKLAPSGFVLLKDLREHEPEVL
SLTDAPTSTASPATGTAAAAQGTPASAMAVDDEPQPPQAFEYAS

www.000webhost.com

Other information
Ka divergence:-0.228685KaKs divergence:-0.179891
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):3006Length 2 (bp):3015Length divergence:0.001
MFE 1 (kcal):-978.41MFE 2 (kcal):-961.11MFE divergence-0.009