Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04930-AT2G32840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hydroxyproline-rich glycoprotein family protein
Function (paralog2):proline-rich family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.20230092629911
Log2 mRNA fold difference:0.97573406432023
Log2 TE fold difference:-0.7738952682037
Sequences
Protein sequence

MSIPDPNSSASLTVSPSLSTASETPVTPVNTVRPPPSQPPPAPPPLPPPTYRPIAPLRHP
NPFQQQSAYSNNLYAHSIPVRRQIQDPSAVLYPFALPGRGFSARPVRGFVADPSVTAGNL
SGYPPRPSFTYDPGPYEQRQMESLLQQFIRERNPQIRPLPRLGLGSPVGLGPIRASPQFL
QPRLSSGKISGENARDDPKFLDWSLSRTESDCTVAPPPTSILDTSRNRKARSKDGALAVV
RGRKVRITEGSSSLYSLGRSWLKNGAHVGIQPQRSGIMKPLPKPLPVDLTTETSVPDDPD
EESADEDKEDEEAVKQLSEKDLLKRHIERAKKVRAQLREERSRRIRRYKERITLILAQSE
DR

MSTPDPNPNPNPNPSVSVAVSTPIVTASESPVTQPNTVITPSSQPQPQTPASSYRAIAPL
HRHHPHQNIYTNPLPIRRSNSVTNSPHQPPHPDPSSLIYPFGSSGRGFPTRPVRQNSNSV
ADPVGSPSPGGYTPRGPVYGYHHGQFVSNLDPMNQFMRAAHPQNQQSPQLGSGHMKGVPH
FLQPRATPSPTSILDNSGHKKARSRDDALVLVRKRKVRITEGASLYSLCRSWLRNGAHEG
IKPQRIDMMTCLPKPLPVDKTETSLPKDLVEEAICEEDKEDEESVKHLSESDLLKRHIDR
AKKVRARLREERLKRIARYKARLALLLPPFGEQCRNE

www.000webhost.com

Other information
Ka divergence:-0.387656KaKs divergence:-0.425763
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1089Length 2 (bp):1014Length divergence:-0.036
MFE 1 (kcal):-312.13MFE 2 (kcal):-284.04MFE divergence-0.047