Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04940-AT1G04945
Species:Arabidopsis
Duplication type:TD
Function (paralog1):translocon at the inner envelope membrane of chloroplasts 20
Function (paralog2):HIT-type Zinc finger family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.5771291903905
Log2 mRNA fold difference:-1.8947964249239
Log2 TE fold difference:-1.6297615405044
Sequences
Protein sequence

MITGYSTPSAHVLMSSRAFKSSSYRAAAGQTQHYLARSSLPVVKNSWGSPPSPFNELPRV
SRGVPLSYLSASSSLLLNGEQGSLSGTLPVLPVRRKTLLTPRASKDVPSSFRFPPMTKKP
QWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFF
VAYLGIVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSKWMPLGVYWGKFGMHFWTAVAFA
YLFTVLESIRCALAGMYADIPFVCDAAYIQIPYD

MITGYSTPSAHVLMSSRAFKSSSYRAAAGQTQHYLARSSLPVVKNSWGSPPSPFNELPRV
SRGVPLSYLSASSSLLLNGEQGSLSGTLPVLPVRRKTLLTPRASKDVPSSFRFPPMTKKP
QWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFF
VAYLGIVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSKWMPLGVYWGKFGMHFWTAVAFA
YLFTVLESIRCALADSVCEECKQNPWKYKCPGCSIRSCALPCVKAHKQRTGCTGKRKFTD
VVPLSKFDDNLLLSDYNMLEETKRVAESALRRRSQLCKNHYSYKLPYLLKSLQSAAYSRR
TKLWYLPSGMLKRENNQSRYDNRSKCISWTIEWRFHSTDVILVDHGVGEDRNLCSVIKNH
LKPGPWIHKLKPFCDVDLDSLKLFIRQYPKGAKAPFKELDIKAPLRKQLAKVVILEYPVI
HVYLPSQSYEFKVIKDFNTTPNPNDSLYDGHGCTNGITFREEEIEEDDIDSFEPEVLGLM
KQMNYNPCLRVSEKSKAEGVGTNNSNPQVDTTEQEDAGNMELEFEQGLIDTYSDLFAEMN
PGDYFNFECEFAKGLDSDDNCNLQNLDTDFIADGLDLEEGEIVE

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:-0.292532
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):825Length 2 (bp):1935Length divergence:0.402
MFE 1 (kcal):-264.18MFE 2 (kcal):-570.54MFE divergence0.367