Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04980-AT2G32920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PDI-like 2-2
Function (paralog2):PDI-like 2-3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5578858836934
Log2 mRNA fold difference:1.8011415051814
Log2 TE fold difference:-0.22784052975903
Sequences
Protein sequence

MERKMYKSTVFPICCLLFALFDRGNALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAP
WCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDY
QGARDAKSISQFAIKQIKALLKDRLDGKTSGTKNGGGSSEKKKSEPSASVELNSSNFDEL
VTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDAEQSIKSRFKVQGF
PTILVFGSDKSSPVPYEGARSASAIESFALEQLESNAGPAEVTELTGPDVMEDKCGSAAI
CFVSFLPDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAAGKQPDLEKRVGVGGYGY
PAMVALNAKKGAYAPLKSGFEVKHLKDFVKEAAKGGKGNLPIDGTMEIVKTEAWDGKDGE
VVDADEFSLEDLMGNDDEASTESKDDL

MYKSPLTLLTLLTICFGFFDLSSALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWC
GHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQG
ARDAKSIANFAYKQIKGLLSDRLEGKSKPTGGGSKEKKSEPSASVELNASNFDDLVIESN
ELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTILV
FGPDKSSPYPYEGARSASAIESFASELVESSAGPVEVTELTGPDVMEKKCGSAAICFISF
LPDILDSKAEGRNKYLEMLLSVAEKFKKQPYSFMWVAAVTQMDLEKRVNVGGYGYPAMVA
MNVKKGVYAPLKSAFELQHLLEFVKDAGTGGKGNVPMNGTPEIVKTKEWDGKDGELIEED
EFSLDELMGGDDAVGSKDEL

www.000webhost.com

Other information
Ka divergence:0.277191KaKs divergence:0.0913349
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1344Length 2 (bp):1323Length divergence:-0.008
MFE 1 (kcal):-417.69MFE 2 (kcal):-402.1MFE divergence-0.019