Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04990-AT2G32930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger C-x8-C-x5-C-x3-H type family protein
Function (paralog2):zinc finger nuclease 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.204229157681
Log2 mRNA fold difference:-1.7445119971314
Log2 TE fold difference:0.62098923367143
Sequences
Protein sequence

MRTPMSDTQHVQSSLVSIRSSDKIEDAFRKMKVNETGVEELNPYPDRPGERDCQFYLRTG
LCGYGSSCRYNHPTHLPQDVAYYKEELPERIGQPDCEYFLKTGACKYGPTCKYHHPKDRN
GAQPVMFNVIGLPMRLGEKPCPYYLRTGTCRFGVACKFHHPQPDNGHSTAYGMSSFPAAD
LRYASGLTMMSTYGTLPRPQVPQSYVPILVSPSQGFLPPQGWAPYMAASNSMYNVKNQPY
YSGSSASMAMAVALNRGLSESSDQPECRFFMNTGTCKYGDDCKYSHPGVRISQPPPSLIN
PFVLPARPGQPACGNFRSYGFCKFGPNCKFDHPMLPYPGLTMATSLPTPFASPVTTHQRI
SPTPNRSDSKSLSNGKPDVKKESSETEKPDNGEVQDLSEDASSP

MSETQQQVQNSTGSIRSPDKIEDTFRRMKVNEDNMEQSSPYPDRPGERDCQFFLRTGQCG
YGNSCRYNHPLTNLPQGIIYYRDQLPERVGQPDCETGACKYGPTCKYHHPKDRNGAGPVL
FNVLGLPMRQGEKPCPYYMQTGLCRFGVACKFHHPHPHSQPSNGHSAYAMSSFPSVGFPY
ASGMTMVSLPPATYGAIPRPQVPQSQAYMPYMVAPSQGLLPPQGWATYMTASNPIYNMKT
QLDSSSSASVAVTVTSHHHSFSERAECRFFMNTGTCKYGDDCKYSHPKERLLQSPPTLLN
PIVLPARPGQPACGNFKAYGFCKFGANCKFDHSMLLNPYNNTGLAMSSLPTPYPYAPPVS
TNLRISSPPSPSDMTTLSNGKPAAAEAQSLETEKQDDSPTEPEKSEVEDSLPPNGSDSTS
LPNDKPDAETEKQDDDSAELDSSKGLEMFYLFFFFFFFFFGFGDSNG

Other information
Ka divergence:0.198964KaKs divergence:0.229361
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1215Length 2 (bp):1404Length divergence:0.072
MFE 1 (kcal):-368.8MFE 2 (kcal):-401.32MFE divergence0.042