Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05000-AT2G32960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphotyrosine protein phosphatases superfamily protein
Function (paralog2):Phosphotyrosine protein phosphatases superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.44269276781137
Log2 mRNA fold difference:-0.020264485423631
Log2 TE fold difference:-0.43755446524566
Sequences
Protein sequence

MKLVEKTTTTEQDNGEDFCRTIIEVSEVNRNVFQAPGGEADPFRVVSGEELHLIPPLNFS
MVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNK
CVPDLDNEISLHLWNSKHQKQGPLTNGLSKTLEPFVNIPDHKIRMALKVLLDEKNHPVLI
HCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSSFSHIPM
SFSCSIR

MKLIEKTMSMNQFRTMEEEKQDGGELFHTIEVAKVDRNNVSQPPPAATAALLEVPGDELN
LIPPLNFSMVDNGIFRSGFPDSANFSFIKTLGLRSIISLCPEPYPENNMQFLKSNGISLF
QFGIEGSKSKCLPGLENEVWLHIWSSKHQKEDFYTNGNSKTSEPFVDILDQKIREALKVL
LDEKNHPLLIHCKRGKHRTGCLVGCMRKLQKWCITSILDEYKRFAAAKARVSDQRFLESF
DVSGLKHTPMSFSCSNR

www.000webhost.com

Other information
Ka divergence:0.283522KaKs divergence:0.254325
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):744Length 2 (bp):774Length divergence:0.02
MFE 1 (kcal):-223.5MFE 2 (kcal):-246.4MFE divergence0.049