Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05070-AT2G32580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1068)
Function (paralog2):Protein of unknown function (DUF1068)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.3159725041183
Log2 mRNA fold difference:1.2396258145886
Log2 TE fold difference:0.067419884487293
Sequences
Protein sequence

MARHTAALKIGLALLGLSMAGYILGPPLYWHLTEALAAVSASSCPSCPCECSTYSAVTIP
KELSNASFADCAKHDPEVNEDTEKNYAELLTEELKLREAESLEKHKRADMGLLEAKKVTS
SYQKEADKCNSGMETCEEAREKAELALAEQKKLTSRWEERARQKGWREGSTKPNVKSKSN
VQVA

MAKHTAALKVGLALLALSMIGYILGPPLYWHLTEALAVSATSCSACVCDCSSLPLLTIPT
GLSNGSFTDCAKRDPEVNEDTEKNYAELLTEELKQREAASMEKHKRVDTGLLEAKKITSS
YQKEADKCNSGMETCEEAREKAEKALVEQKKLTSMWEQRARQKGYKDGATKSTVKSKSGT
EVA

www.000webhost.com

Other information
Ka divergence:0.198967KaKs divergence:0.448291
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):555Length 2 (bp):552Length divergence:-0.003
MFE 1 (kcal):-179.5MFE 2 (kcal):-173.7MFE divergence-0.016