Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05100-AT2G32510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase kinase kinase 18
Function (paralog2):mitogen-activated protein kinase kinase kinase 17

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.11281358902332
Log2 mRNA fold difference:0.87698830644054
Log2 TE fold difference:-1.0009663529089
Sequences
Protein sequence

MNWTRGKTLGRGSTATVSAATCHESGETLAVKSAEFHRSEFLQREAKILSSLNSPYVIGY
RGCEITREPFHNNGEATTYSLLMEYAPYGTLTDVATKNGGFIDEARVVKYTRQILLGLEY
IHNSKGIAHCDIKGSNVLVGENGEAKIADFGCAKWVEPEITEPVRGTPAFMAPEAARGER
QGKESDIWAVGCTVIEMVTGSQPWIGADFTDPVSVLYRVGYLGELPELPCSLTEQAKDFL
GKCLKKEATERWTASQLLNHPFLVNKEPELVTGLVTNSPTSVTDQMFWRSVEEEVSEDRS
SWWECHEDERIGVLSWIGHVVVESTWDLDGEDWITVRRN

MEWTRGRILGRGSTATVYAAAGHNSDEILAVKSSEVHRSEFLQREAKILSSLSSPYVIGY
RGSETKRESNGVVMYNLLMEYAPYGTLTDAAAKDGGRVDETRVVKYTRDILKGLEYIHSK
GIVHCDVKGSNVVISEKGEAKIADFGCAKRVDPVFESPVMGTPAFMAPEVARGEKQGKES
DIWAVGCTMIEMVTGSPPWTKADSREDPVSVLYRVGYSSETPELPCLLAEEAKDFLEKCL
KREANERWTATQLLNHPFLTTKPDIEPVLVPGLISNSPTSVTDQTFWRSVEEEEEEETEE
IQKDSRDLDRLSLWGCYSERIGRLKCVGGLDGTRCDMEGGDWIMVRARCEGTMISGSQKE
LIISENVLVGEL

www.000webhost.com

Other information
Ka divergence:0.0608619KaKs divergence:0.0140044
GC content 1 (%):51GC content 2 (%):47GC content divergence:-0.041
Length 1 (bp):1020Length 2 (bp):1119Length divergence:0.046
MFE 1 (kcal):-347.74MFE 2 (kcal):-342.35MFE divergence-0.008