Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05140-AT2G32480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidase M50 family protein
Function (paralog2):ARABIDOPSIS SERIN PROTEASE

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.67535629622188
Log2 mRNA fold difference:-0.021510837293492
Log2 TE fold difference:0.68595142326443
Sequences
Protein sequence

MLLNISSSPISHRIPHFLSDFNNPTSNFPPKSKTHLPKSNLSTLSNHSLYGTKNRAFYKN
KRNPYNRTQALGRFDFGSLESVLEASAVLTAIIVVHETGHFLAASLQGIRVSKFAIGFGP
ILAKFNSNNVEYSLRAFPLGGFVGFPDNDPDSDIPVDDRNLLKNRPILDRVIVVSAGIVA
NVIFAYAIIFTQVVSVGLPVQESFPGVLVPDVKSFSAASRDGLLPGDVILAVDGTELSNS
GSDSVSKVVDVVKRNPEHNVLLRIERGKESFEIRITPDKSFDGTGKIGVQLSPNVRFGKV
RPKNIPETFSFAGREFFGLSYNVLDSLKQTFLNFSQTASKVAGPVAIIAVGAEVARSNAD
GLYQFAALLNLNLAVINLLPLPALDGGTLALILLEAVRGGRKLPLEVEQGIMSSGIMLVL
FLGLFLIVKDTLNLDFIKEML

MLLNISSSPISHRNPHFLSNFNNPISYFPRRSKTHLSKSHFFPKFTPLSNQSLKNRVLFG
NKRYPDGERFDFRSRAISGIDLGSFESVLEAIAVLTTIIVVHESGHFLAASLQGIHVSKF
AIGFGPILAKFDYNNVEYSLRAFPLGGFVGFPDNDPDSEIPIDDENLLKNRPTLDRSIVV
SAGIIANVIFAYAIIFVQVLSVGLPVQEAFPGVLVPEVKTFSAASRDGLLSGDVILAVDG
TELSKTGPDAVSKIVDIVKRNPKSNVVFRIERGGEDFDIRVTPDKNFDGTGKIGVQLSPN
VRITKVRPRNIPETFRFVGREFMGLSSNVLDGLKQTFFNFSQTASKVAGPVAIIAVGAEV
ARSNIDGLYQFAALLNINLAVINLLPLPALDGGTLALILLEAVRGGKKLPVEVEQGIMSS
GIMLVIFLGLFLIVKDTLSLDFIKEML

www.000webhost.com

Other information
Ka divergence:-0.165902KaKs divergence:-0.218561
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1326Length 2 (bp):1344Length divergence:0.007
MFE 1 (kcal):-398.1MFE 2 (kcal):-387.3MFE divergence-0.014