Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05150-AT2G32450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-binding tetratricopeptide family protein
Function (paralog2):Calcium-binding tetratricopeptide family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.11263528859996
Log2 mRNA fold difference:-0.74873773498034
Log2 TE fold difference:0.87739283550135
Sequences
Protein sequence

MATRGSRSEKVKRIFQQFDGNHDGGLNREEMAALVVAVNPRVKFSDEQINAILDEVFRTY
AEFIDPNKGLTYDGLLRTYDDGAGDVDRDFDALGLELNADETTIKGSEAASSSSITDERA
VEAQKKQRTAAWAVSPNHGIVFDETWKLVDDLEILVKRLKSKQEKDGKLKADNNNNNVDA
FSDAGWSRELGPSSEISEKRIYWEESSHDYGVFVKELGVLRSKADGARSREEAFDGHMAI
GRVLYEHQLFKEALVSFKRACELQPTDVRPHFKAGNCLYVLGKCKESKDEFLLALEAAES
GGNQWAYLLPQIYVNLGIALEGEGMVLSACEYYREAAILCPTHFRALKLLGSALFGVGEY
RAAVKALEEAIYLKPDYADAHCDLASSLHSMGEDERAIEVFQRAIDLKPGHVDALYNLGG
LYMDLGRFQRASEMYTRVLTVWPNHWRAQLNKAVSLLGAGETEEAKRALKEALKLTNRVE
LHDAISHLKHLQKKKGKNNGNGNGGEGPFIVVEPSKFKTVGEKTTLRPDLATALQIRAFQ
RVTRLGKCDVEAVRKEMRDNDVPVSYSGSGGPTKSIRKPNLEEILRRLLSSLKPDTFQGA
IKAINEKILALLDDSGSGRVDMGMFYAVIAPLCGGHSDKRKRVAFDALLWRPVNEGSSQI
TKTDAVKYIKLLRAIYIPSHGMSEMLEVHGEEEAESSVTVTFNQFLAMFDDPDWGFGIMS
TILKLEANDRNRHGNQVCSVCRYPVIGSRFKEVKARFSLCNQCYGEGKVPPSFKQEEYKF
REYESEAEAMKAKCVCFSMQSHKKAIAT

MTTRGSRSEKVKRIFQQFDGNLDGGLSREEMSALVVAVNPRVKFSDEQISAILDEVFRTY
AEFIDGDKGLTFDGLLRTYDDGAGDVDRDFDALGIEFNEETKGASEASSSSITDERAVEA
QKQQRTAAWAVSPNHGIVFDETWKLVDDLEILVKRLKSKQEKDGKLKVDNNNVDAFSEAG
WSRELGPSSDISDKRIYWEESSHDYGVFVKELGVLRSKADGARSREEAFDGHMAIGKVLY
EHQLFKEALVSFKRACELQPTDVRPHFKAGNCLYVLGKYKESKDEFLLALEAAESGGNQW
AYLLPQIYVNLGISLEGEGMVLSACEYYREAAILCPTHYRALKLLGSALFGVGEYRAAVK
ALEEAIYLKPDYADAHCDLASSLHAMGEDERAIEVFQRAIDLKPGHVDALYNLGGLYMDL
GRFQRASEMYTRVLAVWPNHWRAQLNKAVSLLGAGETEEAKRALKEALKMTNRVELHDAV
SHLKQLQKKKKVKKGNSANEEGPFIVVESSKFKTVGEKTTLRPDLAIALQVRAFQRVTRL
WKCDVEALRREMRDNNVPVSYSGNGIPTKSIRRPNLEEILRRLLNVLKPETFQGAIKAIN
EKILSVLDDSGSGRVDLGMFYAVIAPLCGGHPDKRKRVAFDALLWKPVNEGSSQITKMEA
VKYIKLLRAIYIPSQGMSEMLEVHGESDDTSTVTFNQFLEMYDDSEWGFGIMSTVFKLET
RDRNRHGNQVCSVCRYPIIGSRFKEVKTGFSLCNQCYSEGKIPPTFKQQEEYKFREYASE
VEAMKAKCVCFSMQSHKKTIAT

www.000webhost.com

Other information
Ka divergence:0.261885KaKs divergence:0.402181
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2427Length 2 (bp):2409Length divergence:-0.004
MFE 1 (kcal):-761.57MFE 2 (kcal):-747MFE divergence-0.01