Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05160-AT2G32440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 88, subfamily A, polypeptide 3
Function (paralog2):ent-kaurenoic acid hydroxylase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.2187806212103
Log2 mRNA fold difference:0.86837785648512
Log2 TE fold difference:0.37197133489209
Sequences
Protein sequence

MAETTSWIPVWFPLMVLGCFGLNWLVRKVNVWLYESSLGENRHYLPPGDLGWPFIGNMLS
FLRAFKTSDPDSFTRTLIKRYGPKGIYKAHMFGNPSIIVTTSDTCRRVLTDDDAFKPGWP
TSTMELIGRKSFVGISFEEHKRLRRLTAAPVNGHEALSTYIPYIEENVITVLDKWTKMGE
FEFLTHLRKLTFRIIMYIFLSSESENVMDALEREYTALNYGVRAMAVNIPGFAYHRALKA
RKTLVAAFQSIVTERRNQRKQNILSNKKDMLDNLLNVKDEDGKTLDDEEIIDVLLMYLNA
GHESSGHTIMWATVFLQEHPEVLQRAKAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVD
ETLRVITFSLTAFREAKTDVEMNGYLIPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWDN
GFVPKAGAFLPFGAGSHLCPGNDLAKLEISIFLHHFLLKYQVKRSNPECPVMYLPHTRPT
DNCLARISYQ

MTETGLILMWFPLIILGLFVLKWVLKRVNVWIYVSKLGEKKHYLPPGDLGWPVIGNMWSF
LRAFKTSDPESFIQSYITRYGRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPK
STMKLIGRKSFVGISFEEHKRLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKWSKMGEI
EFLSHLRKLTFKVIMYIFLSSESEHVMDSLEREYTNLNYGVRAMGINLPGFAYHRALKAR
KKLVAAFQSIVTNRRNQRKQNISSNRKDMLDNLIDVKDENGRVLDDEEIIDLLLMYLNAG
HESSGHLTMWATILMQEHPMILQKAKEEQERIVKKRAPGQKLTLKETREMVYLSQVIDET
LRVITFSLTAFREAKSDVQMDGYIIPKGWKVLTWFRNVHLDPEIYPDPKKFDPSRWEGYT
PKAGTFLPFGLGSHLCPGNDLAKLEISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNC
LARITRTMP

www.000webhost.com

Other information
Ka divergence:-0.0236125KaKs divergence:-0.0435312
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1473Length 2 (bp):1470Length divergence:-0.001
MFE 1 (kcal):-428.94MFE 2 (kcal):-427.65MFE divergence-0.002