Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05170-AT2G32430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactosyltransferase family protein
Function (paralog2):Galactosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0468590308027
Log2 mRNA fold difference:-0.25182188443691
Log2 TE fold difference:-0.66163511594101
Sequences
Protein sequence

MSAKIKGEYSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSVTEAERLKL
VSEGCNPKALYQKEVKRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNG
APLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRDSIRATWMPQGEKRKRLEEEKGIIIR
FVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWDADFYV
KVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYF
RHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDC
EWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF

MSTKIKGELFPSRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDMPRPSVSTEAERL
KLISEGCDPKTLYQKEVNRDPQALFGEVSKTHNAIQTLDKTISSLEMELAAARSAQESLV
NGAPISNDMEKKQLPGKRRYLMVVGINTAFSSRKRRDSVRTTWMPSGEKRKKLEEEKGII
IRFVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGKTKTYFSTAVSKWDAEF
YVKVDDDVHVNIATLGETLVRHRKKHRVYLGCMKSGPVLSQKGVRYHEPEYWKFGENGNK
YFRHATGQLYAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPP
DCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF

Other information
Ka divergence:-0.21386KaKs divergence:-0.0129601
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1224Length 2 (bp):1230Length divergence:0.002
MFE 1 (kcal):-373.56MFE 2 (kcal):-353.26MFE divergence-0.028