Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05180-AT2G32410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):AXR1-like

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.13698688856296
Log2 mRNA fold difference:-1.6819256776883
Log2 TE fold difference:1.6679881464646
Sequences
Protein sequence

MQAVKRSRRHVEEEPTMVEPKTKYDRQLRIWGEVGQAALEEASICLLNCGPTGSEALKNL
VLGGVGSITVVDGSKVQFGDLGNNFMVDAKSVGQSKAKSVCAFLQELNDSVNAKFIEENP
DTLITTNPSFFSQFTLVIATQLVEDSMLKLDRICRDANVKLVLVRSYGLAGFVRISVKEH
PIIDSKPDHFLDDLRLNNPWPELKSFVETIDLNVSEPAAAHKHIPYVVILVKMAEEWAQS
HSGNLPSTREEKKEFKDLVKSKMVSTDEDNYKEAIEAAFKVFAPRGISSEVQKLINDSCA
EVNSNSSAFWVMVAALKEFVLNEGGGEAPLEGSIPDMTSSTEHYINLQKIYLAKAEADFL
VIEERVKNILKKIGRDPSSIPKPTIKSFCKNARKLKLCRYRMVEDEFRNPSVTEIQKYLA
DEDYSGAMGFYILLRAADRFAANYNKFPGQFDGGMDEDISRLKTTALSLLTDLGCNGSVL
PDDLIHEMCRFGASEIHVVSAFVGGIASQEVIKLVTKQFVPMLGTYIFNGIDHKSQLLKL

MAEPKTKYDRQLRIWGELGQSALETASICLLNCGPTGSEALKNLVIGGIGSITIVDGSKV
EIGDLGNNFMVDAKSVGQSRAKTVCGFLQELNDSVKANFVEENPDTLISTDPSFFSQFTL
VIATQLVEDSMVKLDRICREANVMLVLARSYGLTGFVRISVKEHTAIETKPDHSLDDLRL
NSPWPELKSYVESIDLNVEEPAAHKHIPYVVILVKVAEEWAQHHSGNLPSTREEKNEFKD
LVKSKMVSADEENYKEALLAAFKVFAPTGISQEIQDINHDSCAEVGSNSSDFWVMVAALK
EFISNEGGGEVPLEGSMPDMISSTEHYINLQKIYHSKAEADFLSMEQRVKSILVKVGQDP
SSISKPTIKSFCKNARKLKVCRYRTIEDEFKSPSTTELHKYLADENYSGAIGFYILLRAV
DRFAGTYKKFPGQFDGSTDEDASQLKTIALSLLSEMGCDGYELQEELYNEMCRFGAAEIH
VVAALIGGITSQEVIKLITKQFVPKRGTFIFNGIDHKSQSLTL

www.000webhost.com

Other information
Ka divergence:0.346513KaKs divergence:0.207305
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1623Length 2 (bp):1572Length divergence:-0.016
MFE 1 (kcal):-506.6MFE 2 (kcal):-468MFE divergence-0.04