Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05200-AT2G32390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamate receptor 3.4
Function (paralog2):glutamate receptor 3.5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.9064536779209
Log2 mRNA fold difference:-2.8648006591157
Log2 TE fold difference:0.0061815248987481
Sequences
Protein sequence

MGFLVMIREVSMAKAIRVVLLCVSVLWVVPKECACRSNFSRNSSSSSSSSLRPLRQRPSS
VNVGALFTYDSFIGRAAKPAVKAAMDDVNADQSVLKGIKLNIIFQDSNCSGFIGTMGALQ
LMENKVVAAIGPQSSGIAHMISYVANELHVPLLSFGATDPTLSSLQFPYFLRTTQNDYFQ
MHAIADFLSYSGWRQVIAIFVDDECGRNGISVLGDVLAKKRSRISYKAAITPGADSSSIR
DLLVSVNLMESRVFVVHVNPDSGLNVFSVAKSLGMMASGYVWIATDWLPTAMDSMEHVDS
DTMDLLQGVVAFRHYTIESSVKRQFMARWKNLRPNDGFNSYAMYAYDSVWLVARALDVFF
RENNNITFSNDPNLHKTNGSTIQLSALSVFNEGEKFMKIILGMNHTGVTGPIQFDSDRNR
VNPAYEVLNLEGTAPRTVGYWSNHSGLSVVHPETLYSRPPNTSTANQRLKGIIYPGEVTK
PPRGWVFPNNGKPLRIGVPNRVSYTDYVSKDKNPPGVRGYCIDVFEAAIELLPYPVPRTY
ILYGDGKRNPSYDNLVNEVVADNFDVAVGDITIVTNRTRYVDFTQPFIESGLVVVAPVKE
AKSSPWSFLKPFTIEMWAVTGGFFLFVGAMVWILEHRFNQEFRGPPRRQLITIFWFSFST
MFFSHRENTVSSLGRFVLIIWLFVVLIINSSYTASLTSILTIRQLTSRIEGIDSLVTSNE
PIGVQDGTFARNYLINELNILPSRIVPLKDEEQYLSALQRGPNAGGVAAIVDELPYIEVL
LTNSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDMSTAILQLSEEGELEKIHRKWLNYKHE
CSMQISNSEDSQLSLKSFWGLFLICGITCFMALTVFFWRVFWQYQRLLPESADEERAGEV
SEPSRSGRGSRAPSFKELIKVVDKREAEIKEILKQKSSKKLKSTQSAAGTSQSQHGEIT

MIRDVSMGFMLLCISALWVLPIQGAGRESFSRNSSSSSLPSSVNVGALFTYDSFIGRAAK
LAFVAAIEDINADQSILRGTKLNIVFQDTNCSGFVGTMGALQLMENKVVAAIGPQSSGIG
HIISHVANELHVPFLSFAATDPTLSSLQYPYFLRTTQNDYFQMNAITDFVSYFRWREVVA
IFVDDEYGRNGISVLGDALAKKRAKISYKAAFPPGADNSSISDLLASVNLMESRIFVVHV
NPDSGLNIFSVAKSLGMMGSGYVWITTDWLLTALDSMEPLDPRALDLLQGVVAFRHYTPE
SDNKRQFKGRWKNLRFKESLKSDDGFNSYALYAYDSVWLVARALDVFFSQGNTVTFSNDP
SLRNTNDSGIKLSKLHIFNEGERFLQVILEMNYTGLTGQIEFNSEKNRINPAYDILNIKS
TGPLRVGYWSNHTGFSVAPPETLYSKPSNTSAKDQRLNEIIWPGEVIKPPRGWVFPENGK
PLKIGVPNRVSYKNYASKDKNPLGVKGFCIDIFEAAIQLLPYPVPRTYILYGDGKKNPSY
DNLISEVAANIFDVAVGDVTIITNRTKFVDFTQPFIESGLVVPSSGFLNIDLTKNSADLL
GVKSLQSSGLASQQCSSLTVARCFILLPLLIFRGEYGEHVGKLTSRIEGMDTLIASNEPI
GVQDGTFAWKFLVNELNIAPSRIIPLKDEEEYLSALQRGPRGGGVAAIVDELPYIKALLS
NSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDMSTAILQLAEEGKLEKIRKKWLTYDHECT
MQISDTENYQISVQSFWGLFLICGVVWFIALTLFCWKVFWQYQRLRPEESDEVQARSEEA
GSSRGKSLRAVSFKDLIKVVDKREAEIKEMLKEKSSKKLKDGQSSAENSQSKDHETPQ

Other information
Ka divergence:0.325232KaKs divergence:0.108834
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2880Length 2 (bp):2697Length divergence:-0.033
MFE 1 (kcal):-907.31MFE 2 (kcal):-839.51MFE divergence-0.039