Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05210-AT2G32380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transmembrane protein 97, predicted
Function (paralog2):Transmembrane protein 97, predicted

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.711761629757
Log2 mRNA fold difference:1.9289694482084
Log2 TE fold difference:-0.10555770216985
Sequences
Protein sequence

MGALGKLIDVALFVYFVSMAIIAPLIDGQTSLPSGIYPAFLTDLKSKYIADFGDYLLMEK
PHFLVGLVWHELLFLWPLSIANVYAILAGKSWFGTTCLLYGASLVTSMAAILGDMIGSGK
ASDRLLMMYVPFMGFGILAVLRGLVYRSTKNTGSSGKRSTIMPRRKLA

MGAFCKLIDAVLFLYFALMAVIAPLIDGQTSLPGDIFPAFIVDLNRWYIDEFGDYLVKEK
PHFLVGLVWHELLLLWPLSIVNVYAILAGKSWFGTTSMVYGASVVTSMAAILGEMIGSGK
ASEKLLMMYVPFMGVGILALLRGLLSQSNKSGGAVGKRPAILARRKRA

www.000webhost.com

Other information
Ka divergence:-0.323412KaKs divergence:0.23146
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):507Length 2 (bp):507Length divergence:0
MFE 1 (kcal):-153.12MFE 2 (kcal):-160.64MFE divergence0.024