Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05230-AT2G32370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeodomain GLABROUS 2
Function (paralog2):homeodomain GLABROUS 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.94916835420149
Log2 mRNA fold difference:1.6337271301141
Log2 TE fold difference:-0.58433735994976
Sequences
Protein sequence

MFEPNMLLAAMNNADSNNHNYNHEDNNNEGFLRDDEFDSPNTKSGSENQEGGSGNDQDPL
HPNKKKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELNLEPLQVKFWFQNKRTQMK
NHHERHENSHLRAENEKLRNDNLRYREALANASCPNCGGPTAIGEMSFDEHQLRLENARL
REEIDRISAIAAKYVGKPVSNYPLMSPPPLPPRPLELAMGNIGGEAYGNNPNDLLKSITA
PTESDKPVIIDLSVAAMEELMRMVQVDEPLWKSLVLDEEEYARTFPRGIGPRPAGYRSEA
SRESAVVIMNHVNIVEILMDVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQVMSAEF
QVPSPLVPTRETYFARYCKQQGDGSWAVVDISLDSLQPNPPARCRRRASGCLIQELPNGY
SKVTWVEHVEVDDRGVHNLYKHMVSTGHAFGAKRWVAILDRQCERLASVMATNISSGEVG
VITNQEGRRSMLKLAERMVISFCAGVSASTAHTWTTLSGTGAEDVRVMTRKSVDDPGRPP
GIVLSAATSFWIPVPPKRVFDFLRDENSRNEWDILSNGGVVQEMAHIANGRDTGNCVSLL
RVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNIVLNGGDPDYVALLPSGFAILP
DGNANSGAPGGDGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASMSCET
A

MSQSNMVPVANNGDNNNDNENNNNNNNNGGTDNTNAGNDSGDQDFDSGNTSSGNHGEGLG
NNQAPRHKKKKYNRHTQLQISEMEAFFRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKR
TQNKNQQERFENSELRNLNNHLRSENQRLREAIHQALCPKCGGQTAIGEMTFEEHHLRIL
NARLTEEIKQLSVTAEKISRLTGIPVRSHPRVSPPNPPPNFEFGMGSKGNVGNHSRETTG
PADANTKPIIMELAFGAMEELLVMAQVAEPLWMGGFNGTSLALNLDEYEKTFRTGLGPRL
GGFRTEASRETALVAMCPTGIVEMLMQENLWSTMFAGIVGRARTHEQIMADAAGNFNGNL
QIMSAEYQVLSPLVTTRESYFVRYCKQQGEGLWAVVDISIDHLLPNINLKCRRRPSGCLI
QEMHSGYSKVTWVEHVEVDDAGSYSIFEKLICTGQAFAANRWVGTLVRQCERISSILSTD
FQSVDSGDHITLTNHGKMSMLKIAERIARTFFAGMTNATGSTIFSGVEGEDIRVMTMKSV
NDPGKPPGVIICAATSFWLPAPPNTVFDFLREATHRHNWDVLCNGEMMHKIAEITNGIDK
RNCASLLRHGHTSKSKMMIVQETSTDPTASFVLYAPVDMTSMDITLHGGGDPDFVVILPS
GFAIFPDGTGKPGGKEGGSLLTISFQMLVESGPEARLSVSSVATTENLIRTTVRRIKDLF
PCQTA

www.000webhost.com

Other information
Ka divergence:0.70612KaKs divergence:0.684636
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):2166Length 2 (bp):2178Length divergence:0.003
MFE 1 (kcal):-710.65MFE 2 (kcal):-694.37MFE divergence-0.012