Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05270-AT2G32340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TraB family protein
Function (paralog2):TraB family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.430399369892
Log2 mRNA fold difference:-4.487616355347
Log2 TE fold difference:1.0193466920464
Sequences
Protein sequence

MTIEPTQSPSSEPEVHSGEDFVHIDDPRPTGDISLSDSIVNVEKDELLDEAAEEEFRGSD
SVFSGGDGGGADDDGGECSSEATKVELPEELAKSVVILTCESTADGGSCDVYLVGTAHVS
KQSCLEVEAIISILKPEVVFVELCSSRLSVLKPQTLKIPTMSDMIESWKQKQNTFGILYG
WFLAKIASHLEVFPGAEFRVAYEEAIKYGGKVILGDRPVQITLKRTWAKMPLWHKVKFLY
SILFQAVFLPGAEELEKMLKDMDNVDMVTLVIQEMSKEFPTLMDTIVHERDQYMASSLLR
VASDHSSVVAVIGKGHINGIKKNWKQPITMNDLMEIPSDKSVFTLKRIISSVAVAVAGTA
IVSGILLSRRK

MELKPEVQYGDFSLTNSLVNVDKEDLRREEADSDAGSVIICDHSICDSGDGDICAVADYV
ECVAVETTEKLELPEEFAKSVMVLTCESTAEGGSCDVYLVGTAHVSQESCREVEAVISAL
KPQAVFLELCSSRLSILTPQTVKVCCQEPPTWMEMIYMWKKKHNLFEIVYGYILAKAAKK
LEVFPGAEFRVGFEEANKYGGRVFLGDRSVQITLQRTWGKMPLWHKIKLVYSIVSQAVFL
PNPKELEKMLKDLGDGDMLTLAIQEMSTEFPTLMETLVHERDKYMAYQLLRIASEHSSVV
AVVGRGHLQGIKKNWNQTINIKELMELPTNESIFTVKNILKYMVVVVVGTAIVSGMYLAK

Other information
Ka divergence:0.205455KaKs divergence:0.516154
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1116Length 2 (bp):1083Length divergence:-0.015
MFE 1 (kcal):-336MFE 2 (kcal):-315.51MFE divergence-0.031