Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05300-AT2G32270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc transporter 5 precursor
Function (paralog2):zinc transporter 3 precursor

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.4489865570842
Log2 mRNA fold difference:0.001467789405038
Log2 TE fold difference:0.49345954213737
Sequences
Protein sequence

MRITQNVKLLLFFFFFISFLFIAVSAGESKCECSHEDDEANKAGAKKYKIAAIPSVLAAG
VIGVMFPLLGKFFPSLKPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKGEAW
EFPFTGFIAMVAAILTLSVDSFATSYFHKAHFKTSKRIGDGEEQDAGGGGGGGDELGLHV
HAHGHTHGIVGVESGESQVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFA
ALMFHQCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISSSYDDSSPTAL
IVQGVLNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGVMSLLAKWA

MKTKNVKLLFFFFSVSLLLIAVVNAAEGHSHGGPKCECSHEDDHENKAGARKYKIAAIPT
VLIAGIIGVLFPLLGKVFPSLRPETCFFFVTKAFAAGVILATGFMHVLPEAYEMLNSPCL
TSEAWEFPFTGFIAMIAAILTLSVDTFATSSFYKSHCKASKRVSDGETGESSVDSEKVQI
LRTRVIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQCFEGLGLGGCIAQGK
FKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAASAGILIYMSLVD
LLAADFTHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA

Other information
Ka divergence:0.117047KaKs divergence:-0.170184
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1083Length 2 (bp):1020Length divergence:-0.03
MFE 1 (kcal):-346.97MFE 2 (kcal):-307.07MFE divergence-0.061