Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05320-AT2G32240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.5005570027901
Log2 mRNA fold difference:2.4937890437612
Log2 TE fold difference:0.89957020719678
Sequences
Protein sequence

MEEATKVSSDVPQAKEVTKEDTVMEKEEEDTIFDGGFVKVEKEGINKKYDDDDDEKAEKQ
LKSLEDALQLHDVKHKELTEVKEAFDGLGLELENSRKKMIELEDRIRISALEAEKLEELQ
KQSASELEEKLKISDERYSKTDALLSQALSQNSVLEQKLKSLEELSEKVSELKSALIVAE
EEGKKSSIQMQEYQEKVSKLESSLNQSSARNSELEEDLRIALQKGAEHEDIGNVSTKRSV
ELQGLFQTSQLKLEKAEEKLKDLEAIQVKNSSLEATLSVAMEKERDLSENLNAVMEKLKS
SEERLEKQAREIDEATTRSIELEALHKHSELKVQKTMEDFSSRDTEAKSLTEKSKDLEEK
IRVYEGKLAEACGQSLSLQEELDQSSAENELLADTNNQLKIKIQELEGYLDSEKETAIEK
LNQKDTEAKDLITKLKSHENVIEEHKRQVLEASGVADTRKVEVEEALLKLNTLESTIEEL
EKENGDLAEVNIKLNQKLANQGSETDDFQAKLSVLEAEKYQQAKELQITIEDLTKQLTSE
RERLRSQISSLEEEKNQVNEIYQSTKNELVKLQAQLQVDKSKSDDMVSQIEKLSALVAEK
SVLESKFEQVEIHLKEEVEKVAELTSKLQEHKHKASDRDVLEEKAIQLHKELQASHTAIS
EQKEALSHKHSELEATLKKSQEELDAKKSVIVHLESKLNELEQKVKLADAKSKETESTGK
EEEVEVKSRDSDLSFSNPKQTKIKKNLDAASSSGHVMIQKAETWHLMTLKIALGVALVSV
ILGIIVGKNY

MEEATQVTSSEVPVVKGDVDDLKTADISVKAVNGEVPKEEKEEEDGEFIKVEKEAFDAKD
DAEKADHVPVEEQKEVIERSSSGSQRELHESQEKAKELELELERVAGELKRYESENTHLK
DELLSAKEKLEETEKKHGDLEVVQKKQQEKIVEGEERHSSQLKSLEDALQSHDAKDKELT
EVKEAFDALGIELESSRKKLIELEEGLKRSAEEAQKFEELHKQSASHADSESQKALEFSE
LLKSTKESAKEMEEKMASLQQEIKELNEKMSENEKVEAALKSSAGELAAVQEELALSKSR
LLETEQKVSSTEALIDELTQELEQKKASESRFKEELSVLQDLDAQTKGLQAKLSEQEGIN
SKLAEELKEKELLESLSKDQEEKLRTANEKLAEVLKEKEALEANVAEVTSNVATVTEVCN
ELEEKLKTSDENFSKTDALLSQALSNNSELEQKLKSLEELHSEAGSAAAAATQKNLELED
VVRSSSQAAEEAKSQIKELETKFTAAEQKNAELEQQLNLLQLKSSDAERELKELSEKSSE
LQTAIEVAEEEKKQATTQMQEYKQKASELELSLTQSSARNSELEEDLRIALQKGAEHEDR
ANTTHQRSIELEGLCQSSQSKHEDAEGRLKDLELLLQTEKYRIQELEEQVSSLEKKHGET
EADSKGYLGQVAELQSTLEAFQVKSSSLEAALNIATENEKELTENLNAVTSEKKKLEATV
DEYSVKISESENLLESIRNELNVTQGKLESIENDLKAAGLQESEVMEKLKSAEESLEQKG
REIDEATTKRMELEALHQSLSIDSEHRLQKAMEEFTSRDSEASSLTEKLRDLEGKIKSYE
EQLAEASGKSSSLKEKLEQTLGRLAAAESVNEKLKQEFDQAQEKSLQSSSESELLAETNN
QLKIKIQELEGLIGSGSVEKETALKRLEEAIERFNQKETESSDLVEKLKTHENQIEEYKK
LAHEASGVADTRKVELEDALSKLKNLESTIEELGAKCQGLEKESGDLAEVNLKLNLELAN
HGSEANELQTKLSALEAEKEQTANELEASKTTIEDLTKQLTSEGEKLQSQISSHTEENNQ
VNAMFQSTKEELQSVIAKLEEQLTVESSKADTLVSEIEKLRAVAAEKSVLESHFEELEKT
LSEVKAQLKENVENAATASVKVAELTSKLQEHEHIAGERDVLNEQVLQLQKELQAAQSSI
DEQKQAHSQKQSELESALKKSQEEIEAKKKAVTEFESMVKDLEQKVQLADAKTKETEAMD
VGVKSRDIDLSFSSPTKRKSKKKPEASLSSSSSSGNVTTPTQTASTSHLMTVKIVTGVAL
ISVIIGIILGRKY

Other information
Ka divergence:-0.285192KaKs divergence:-0.401139
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):2373Length 2 (bp):4002Length divergence:0.256
MFE 1 (kcal):-628.2MFE 2 (kcal):-1161.75MFE divergence0.298