Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05420-AT2G32100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ovate family protein 12
Function (paralog2):ovate family protein 16

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.0633306984019
Log2 mRNA fold difference:3.994225945244
Log2 TE fold difference:-1.286256208139
Sequences
Protein sequence

MPRVMWKNFHLCFPSNLTKPSSSPSGATSDDPNRPSILLINNFNLLYDDSSAAHRRLSKP
LIHDVEPSSTFTASTSTAANSSSSSASYDDSDNYGFAPDDDSPPPDLTAVLASRRFFFSS
PGCSNSITDSPDLRCRDNYDTATRLLTGGTAVKHYVQSPDPYNDFRRSMQEMIDAVTNAG
DLRRYEFLHELLLSYLSLNAADTHKFIIRAFADILVSLLSDGHRIS

MPKILWKSLHLCFPSNLTKCYSSPCIPPSSADPDGIIQPNRPSIVLLNNFNLLYHNDNHH
HPHRVIDLPSSSTTTTPAATSSSSTSSYESDISPDVSAAFASRRFFFSSPGRSNAITDSP
EPRSREFSDNYDDATITSTKKKKKKVYDNSVTTTTTRLISGGTAVTQHVDSPDPLTDFRR
SMQEMIDAAIDAGELSRDPNDGYDFLDELLLTYLSLNPADTHKFVIRAFSDILVSLLSEE
RRIC

Other information
Ka divergence:0.198948KaKs divergence:-0.999647
GC content 1 (%):52GC content 2 (%):49GC content divergence:-0.03
Length 1 (bp):681Length 2 (bp):735Length divergence:0.038
MFE 1 (kcal):-140.2MFE 2 (kcal):-174.15MFE divergence0.108