Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05470-AT2G32010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAse I-like superfamily protein
Function (paralog2):CVP2 like 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.42274252369377
Log2 mRNA fold difference:0.26827897922152
Log2 TE fold difference:0.13489235819763
Sequences
Protein sequence

MREEKSKTNKLAWSKKMVRKWFNIKSKTEEFQADDPSSAGIEVEHRSSFSAEKAPSTIKN
TKTEKLSKNWEQQARQRRMNYENPRIIDVQNYSIFVATWNVAGRSPPSDLNLDEWLHSSA
PADIYVLGFQEIVPLNAGNVLGAEDNGPAQKWLSLIRKTLNNRPGTSGTSGYHTPSPIPV
PMAELDADFSGSTRQKNSTFFHRRSFQTPSSTWNDPSIPQPGLDRRFSVCDRVFFSHRPS
DFDPSFRGSSSSHRPSDYSRRPSDYSRRPSDYSRRPSDYSRRPSDSRPSDYSRPSDYYSR
PSDYSRPSDFSRSSDDDNGLGDSPSTVLYSPGSAANENGYRIPWNSSQYCLVASKQMVGV
FLTIWVKSELREHVKNMKVSCVGRGLMGYLGNKGSISISMLLHQTSFCFVCTHLTSGQKE
GDELKRNSDVMEILKKTRFPRVKSSEEEKSPENILQHDRVIWLGDLNYRIALSYRSAKAL
VEMQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDLHPKEKRR
TPAWCDRILWFGEGLHQLSYVRGESRFSDHRPVYGIFCAEVESAHNRIKRTTSYSASRVQ
AEELLPYSRGYTELSFF

MRDDKTKKSKLSWSKKMVRKWFNIKSKTEKFQADVSLPQGVEVEHRNSFSEREPCTIKKS
KTEKLNKNWEQQARQRKMNYENPRIIDVQNHSIFVATWNVAGRSPPEDLNLDEWLHSSAP
ADIYVLGFQEIVPLNAGNVLGAEDNGPAKKWHSLIRKTLNNLPGASSACHTPSPIPVPIA
EIDADFSGSSRQKNETFFNRRSFQTPSVWSMEENDPSISQPRLDRRFSVCDRVFFSHRPS
DFDPSFRCGHRPSDYSRRPSDYSRPSDYYSRPSNYSRPSDVSRWGSSDDDNGPGDSPSTF
LNSPGSFLGSAANENGYRTPWNSSQYCLVASKQMVGIFLTIWVKSELREHVKNMKVSCVG
RGLMGYLGNKGSISISMLLHQTSFCFVCTHLTSGQKEGDELRRNSDVMEILKKTRFPRVQ
SSADEKSPENILQHDRVIWLGDLNYRIALSYRSAKALVEMQNWRALLENDQLRIEQKRGH
VFKGWNEGKIYFPPTYKYSNNSDRYAGGDLHPKEKRRTPAWCDRILWHGEGLHQLSYVRG
ESRFSDHRPVYGIFSAEVESNHKRSKRTNSHSTARVEAEELLPYARGYTELTFF

Other information
Ka divergence:-0.0883982KaKs divergence:0.104193
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1854Length 2 (bp):1785Length divergence:-0.019
MFE 1 (kcal):-566.42MFE 2 (kcal):-542.48MFE divergence-0.022