Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05530-AT1G05560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-glucosyl transferase 75B2
Function (paralog2):UDP-glucosyltransferase 75B1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.1027275352816
Log2 mRNA fold difference:4.2294013877584
Log2 TE fold difference:-0.20909088375581
Sequences
Protein sequence

MAQPHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVIHRSMIPNHNNVENLSF
LTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVP
KVARRFHLPSVHLWIQPAFAFDIYYNYSTGNNSVFEFPNLPSLEIRDLPSFLSPSNTNKA
AQAVYQELMDFLKEESNPKILVNTFDSLEPEFLTAIPNIEMVAVGPLLPAEIFTGSESGK
DLSRDHQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGGRPFLWVITDK
LNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLE
SLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVRENSEGLVERGEIMRCLEAVMEAKSV
ELRENAEKWKRLATEAGREGGSSDKNVEAFVKSLF

MAPPHFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSF
LTFSDGFDDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAP
KVARRFQLPSALLWIQPALVFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPSNTNKG
AYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSTNKS
VKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNR
ETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLV
LGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVMEEKSVELR
ENAKKWKRLAMEAGREGGSSDKNMEAFVEDICGESLIQNLCEAEEVKVK

Other information
Ka divergence:-0.103087KaKs divergence:0.857061
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1368Length 2 (bp):1410Length divergence:0.015
MFE 1 (kcal):-412.63MFE 2 (kcal):-437.52MFE divergence0.029