Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05570-AT2G31960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):callose synthase 1
Function (paralog2):glucan synthase-like 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.64810405325457
Log2 mRNA fold difference:0.86267425552673
Log2 TE fold difference:-0.2378322167157
Sequences
Protein sequence

MAQRREPDPPPPQRRILRTQTVGSLGEAMLDSEVVPSSLVEIAPILRVANEVEASNPRVA
YLCRFYAFEKAHRLDPTSSGRGVRQFKTALLQRLERENETTLAGRQKSDAREMQSFYQHY
YKKYIQALLNAADKADRAQLTKAYQTAAVLFEVLKAVNQTEDVEVADEILETHNKVEEKT
QIYVPYNILPLDPDSQNQAIMRLPEIQAAVAALRNTRGLPWTAGHKKKLDEDILDWLQSM
FGFQKDNVLNQREHLILLLANVHIRQFPKPDQQPKLDDRALTIVMKKLFRNYKKWCKYLG
RKSSLWLPTIQQEVQQRKLLYMGLYLLIWGEAANLRFMPECLCYIYHHMAFELYGMLAGS
VSPMTGEHVKPAYGGEDEAFLQKVVTPIYQTISKEAKRSRGGKSKHSVWRNYDDLNEYFW
SIRCFRLGWPMRADADFFCQTAEELRLERSEIKSNSGDRWMGKVNFVEIRSFWHIFRSFD
RLWSFYILCLQAMIVIAWNGSGELSAIFQGDVFLKVLSVFITAAILKLAQAVLDIALSWK
ARHSMSLYVKLRYVMKVGAAAVWVVVMAVTYAYSWKNASGFSQTIKNWFGGHSHNSPSLF
IVAILIYLSPNMLSALLFLFPFIRRYLERSDYKIMMLMMWWSQPRLYIGRGMHESALSLF
KYTMFWIVLLISKLAFSYYAEIKPLVGPTKDIMRIHISVYSWHEFFPHAKNNLGVVIALW
SPVILVYFMDTQIWYAIVSTLVGGLNGAFRRLGEIRTLGMLRSRFQSIPGAFNDCLVPQD
NSDDTKKKRFRATFSRKFDQLPSSKDKEAARFAQMWNKIISSFREEDLISDREMELLLVP
YWSDPDLDLIRWPPFLLASKIPIALDMAKDSNGKDRELKKRLAVDSYMTCAVRECYASFK
NLINYLVVGEREGQVINDIFSKIDEHIEKETLITELNLSALPDLYGQFVRLIEYLLENRE
EDKDQIVIVLLNMLELVTRDIMEEEVPSLLETAHNGSYVKYDVMTPLHQQRKYFSQLRFP
VYSQTEAWKEKIKRLHLLLTVKESAMDVPSNLEARRRLTFFSNSLFMDMPPAPKIRNMLS
FSVLTPYFSEDVLFSIFGLEQQNEDGVSILFYLQKIFPDEWTNFLERVKCGNEEELRARE
DLEEELRLWASYRGQTLTKTVRGMMYYRKALELQAFLDMAKDEELLKGYKALELTSEEAS
KSGGSLWAQCQALADMKFTFVVSCQQYSIHKRSGDQRAKDILRLMTTYPSIRVAYIDEVE
QTHKESYKGTEEKIYYSALVKAAPQTKPMDSSESVQTLDQLIYRIKLPGPAILGEGKPEN
QNHAIIFTRGEGLQTIDMNQDNYMEEAFKMRNLLQEFLEKHGGVRCPTILGLREHIFTGS
VSSLAWFMSNQENSFVTIGQRVLASPLKVRFHYGHPDIFDRLFHLTRGGICKASKVINLS
EDIFAGFNSTLREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDLYRLGH
RFDFFRMLSCYFTTIGFYFSTMLTVLTVYVFLYGRLYLVLSGLEEGLSSQRAFRNNKPLE
AALASQSFVQIGFLMALPMMMEIGLERGFHNALIEFVLMQLQLASVFFTFQLGTKTHYYG
RTLFHGGAEYRGTGRGFVVFHAKFAENYRFYSRSHFVKGIELMILLLVYQIFGQSYRGVV
TYILITVSIWFMVVTWLFAPFLFNPSGFEWQKIVDDWTDWNKWIYNRGGIGVPPEKSWES
WWEKELEHLRHSGVRGITLEIFLALRFFIFQYGLVYHLSTFKGKNQSFWVYGASWFVILF
ILLIVKGLGVGRRRFSTNFQLLFRIIKGLVFLTFVAILITFLALPLITIKDLFICMLAFM
PTGWGMLLIAQACKPLIQQLGIWSSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTR
MLFNQAFSRGLQISRILGGQRKDRSSKNKE

MAQRKGPDPPPPQRRILRTQTAGNLGEAMLDSEVVPSSLVEIAPILRVANEVEASNPRVA
YLCRFYAFEKAHRLDPTSSGRGVRQFKTALLQRLERENETTLAGRQKSDAREMQSFYQHY
YKKYIQALQNAADKADRAQLTKAYQTAAVLFEVLKAVNQTEDVEVADEILEAHTKVEEKS
QIYVPYNILPLDPDSQNQAIMRFPEIQATVSALRNTRGLPWPAGHKKKLDEDMLDWLQTM
FGFQKDNVSNQREHLILLLANVHIRQFPRPEQQPRLDDRALTIVMKKLFKNYKKWCKYLG
RKSSLWLPTIQQEVQQRKLLYMGLYLLIWGEAANLRFLPECLCYIYHHMAFELYGMLAGS
VSPMTGEHVKPAYGGEDEAFLQKVVTPIYKTIAKEAKRSRGGKSKHSEWRNYDDLNEYFW
SIRCFRLGWPMRADADFFCQTAEELRLDRSENKPKTGDRWMGKVNFVEIRSFWHIFRSFD
RMWSFYILSLQAMIIIAWNGSGKLSGIFQGDVFLKVLSIFITAAILKLAQAVLDIALSWK
SRHSMSFHVKLRFIFKAVAAAIWVVLMPLTYAYSWKTPSGFAETIKNWFGGHQNSSPSFF
IIVILIYLSPNMLSTLLFAFPFIRRYLERSDYKIVMLMMWWSQPRLYIGRGMHESALSLF
KYTMFWVVLLISKLAFSFYAEIKPLVKPTKDIMRVHISVYRWHEFFPHAKSNMGVVIALW
SPVILVYFMDTQIWYAIVSTLVGGLNGAFRRLGEIRTLGMLRSRFQSLPEAFNACLVPNE
KSETPKKKGIMATFTRKFDQVPSSKDKEAARFAQMWNKIISSFREEDLISDREMELLLVP
YWADRDLDLIRWPPFLLASKIPIALDMAKDSNGKDRELTKRLSVDSYMTCAVRECYASFK
NLINFLVVGEREGQVINEIFSRIDEHIEKETLIKDLNLSALPDLYGQFVRLIEYLMENRE
EDKDQIVIVLLNMLEVVTRDIMDEEVPSMLESTHNGTYVKYDVMTPLHQQRKYFSQLRFP
VYSQTEAWKEKIKRLHLLLTVKESAMDVPSNLEARRRLTFFSNSLFMEMPDAPKIRNMLS
FSVLTPYYSEDVLFSIFGLEKQNEDGVSILFYLQKIFPDEWTNFLERVKCGSEEELRARE
ELEEELRLWASYRGQTLTKTVRGMMYYRKALELQAFLDMAKDEELMKGYKALELTSEDAS
KSGTSLWAQCQALADMKFTFVVSCQQYSVQKRSGDQRAKDILRLMTTYPSLRVAYIDEVE
QTHKESYKGADEKIYYSALVKAAPQTKSMDSSESVQTLDQVIYRIKLPGPAILGEGKPEN
QNHSIIFTRGEGLQTIDMNQDNYMEEAFKMRNLLQEFLVKHGGVRTPTILGLREHIFTGS
VSSLAWFMSNQENSFVTIGQRVLASPLKVRFHYGHPDVFDRLFHLTRGGVCKASKVINLS
EDIFAGFNSTLREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDLYRLGH
RFDFFRMLSCYFTTIGFYFSTMLTVLTVYVFLYGRLYLVLSGLEEGLSNQKAFRSNMPLQ
AALASQSFVQIGFLMALPMMMEIGLERGFHNALIDFVLMQLQLASVFFTFQLGTKTHYYG
RTLFHGGAEYRGTGRGFVVFHAKFAENYRFYSRSHFVKGIELMILLLVYQIFGHAYRGVV
TYILITVSIWFMVVTWLFAPFLFNPSGFEWQKIVDDWTDWNKWIYNRGGIGVPPEKSWES
WWEKEIGHLRHSGKRGIILEIVLALRFFIFQYGLVYQLSTFKQENQSLWIYGASWFVILF
ILLIVKGLGVGRQRFSTNFQLLFRIIKGFVFLTFLGLLITFLALRFLTPKDIFLCMLAFM
PTGWGMLLIAQACKPLIQRLGFWSSVRTLARGYEILMGLLLFTPVAFLAWFPFVSEFQTR
MLFNQAFSRGLQISRILGGQRKDRSSKNKE

Other information
Ka divergence:-0.0156509KaKs divergence:0.204528
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):5853Length 2 (bp):5853Length divergence:0
MFE 1 (kcal):-1783.18MFE 2 (kcal):-1786.1MFE divergence0.001