Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05575-AT2G31945
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2500821033203
Log2 mRNA fold difference:-1.9103287336327
Log2 TE fold difference:0.53294952151942
Sequences
Protein sequence

MEGSFEGMLMKVSIFALIQGLVYLILSKSSSVFSTSKTMKRAYSFRSARSISIRRILAVL
QDMPAGGEMSPSAMGPSLASSLSSPSEII

MDGGLGTMLMKVALFALVQGLVYLILLKSSRVFARSNSLKRAYSFRPMRSVSIRRILAAL
QDIPAGDDMSPSSNGSSSSSQDEAATTTTTSSSPS

Other information
Ka divergence:0.0848033KaKs divergence:0.999859
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):270Length 2 (bp):288Length divergence:0.032
MFE 1 (kcal):-77.04MFE 2 (kcal):-94.7MFE divergence0.103