Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05630-AT2G31830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Endonuclease/exonuclease/phosphatase family protein
Function (paralog2):endonuclease/exonuclease/phosphatase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.040289011556558
Log2 mRNA fold difference:-0.78585102458423
Log2 TE fold difference:0.73280904928737
Sequences
Protein sequence

MDSLIIEEEDEEALATLVPVPPRRKTHSYSLQFDHKPHHQIRKHSLDEVPRSATLASEAV
YFDSSDDEFSTGGNITENAADETNAGAEEYTIVNPPPNVGLGDDDTEPLPEFIGAGGGSG
IFKVPVRAAVHPGRPPCLELRPHPLRETQTGRFLRNIACTETQLWAGQENGIRFWNLEDA
YEAGCGIGGQVPRGDEDTAPFHESVTTSPTMCLVADQSNKLLWSGHKDGKIRAWKMDQSS
VSHDDDDSDPFKERVSWLAHRGPVNSIVISSYGDMWSCSEGGVIKIWPWDTLEKSLLLKP
EEKHMAALLVERSAIDLRSQVTVNGTCSISSSEVKFLLADSVRAKVWAVQSLSFSIWDAR
SKDLLKVLNVDGQVENRGDLPPIQDQQVDDEMKLKFFSASKREKPQGFLQRSRNAIMGAA
GAVRRVATRSAGAFSEDTRKTEAIVLAVDGTIWTGSISGLIVQWDGNGNRLRDVNHHHRP
VLCFCTFGDRIYVGYASGYIQVLDLDGKLISSWVSHNEPVIKLAAGGGFIFSLATHGGVR
GWYVTSPGPLDNIIRTELSQKETLYARQDNVRILIGTWNVGQGRASHDALMSWLGSVTSD
VGIVAVGLQEVEMGAGFLAMSAAKETVGLEGSAVGQWWIDAIGKALDEKNTFERMGSRQL
AGLLISLWARKDIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVYDRIMCFVNCHLAAH
LEAVNRRNADFNHIFRLMVFSRGQNLSNAAAGMVPYLFLSCSLGFSTYLFWLLYSSGLPW
ALSLAAGVSTSAYTTKSNTIPSTGAEEIKSDLAAADMVAFFGDFNYRLFGITYDEARDFI
SQRSFDWLRERDQLRAEMKVGKVFQGMREALITFPPTYKFERNRSGLGGYDSGEKKRIPA
WCDRVIYRDTQSSPFSESNLQCPVVSSVIMYEACMDVTESDHKPVRCKFHATIAHVDKSV
RRQELGKIIRSNEKILSIFEDLRFVPETSVSTNNIVLQSQDTVILTITNNSPTSQAIFNI
LCGGQAVVKDDGEDADYNPRGSFGLPRWLEVSPAAGIINPEGSVDVKVHHEDFYSMEEYV
DGIPQNWWCEDTRDKEAILMVNIRGSCSTTLRSHSVKVRHCFSARVCLLENRPTNLTKNL
GGSRRYPTDITRNGSTRPRTEDSVRRGKSR

MDSVIIEPDEREALASLVPAHPLPPRKTHSYVEQCEQKPHHPIRKYSLDEGSRSVTSDSE
AVYFDSSDGEFSTEGVAIVDGRTSGERGNGEECGFVTPPSKPASQGGGNDGGREDDIESL
PEFIGAGGGLDVFKVPVRAAVNPGRPPCLELRPHPLRETQTGKFLRNIACTESQLWAGQE
NGVRFWNLEEAYEVGCGLGGQVRRGDEDTAPFHESVPTSPALCLLVDHGNRLVWTGHKDG
KIRAWKMNQPNTTTADDSKPFKERLSWQAHRGPVNYIVISSYGDMWSCSDGGVIKIWTLD
SLEKSLVLKLEEKHMAALLVERSGIDLRSQVTVNGTCSISSSDVKFLLVDTVKAKVWAVQ
HLSFSLWDAQNKELLKVFNIDGQVENRVDMPPTQGQQVEDTKAKFFSAPKKEKSQGFLQR
SRHAIMGAAGAVRRAATRSAGAFAEDTRKVEAIAIAADGSIWTGSMNGVIAQWDGNGSRL
REVNHHQQAVLCFCTFGDRIYVGYSSGYIQVLDLGGKLIASWVSHNEPVIKLAAGGGFIF
SLATHGGVRGWYVTSPGPLDSLIRTELSQKEMAYARQDSVKILIGTWNVGEGRASRGALV
SWLGSAVSDVGIVAIGLQEVDMGAGFLAMSTAKETVGVEGSAVGQWWLDAIGNALDERNT
FERMGSRQLAGLLISLWVRKSIRTHVGDLDVAAVPCGFGRAIGNKGGVGLRIRVYDRIMC
FVNCHLAAHLEAVTRRNADFNHIYRSMVFSKGQSVYTAAAAGASTSAQALKNNPNTNNST
EEEKSHLASADLVAFFGDFNYRLFGITYDEARDFISHRSFDWLREKDQLRQEMNEGKVFQ
GMREALITFPPTYKFEKNKPGLGGYDSGEKKRIPAWCDRVIYRDNQSISYTECSLKCPVV
SSTIMYEACMDVTESDHKPVRCKLHANIAHTDKSVRRQELGKIVKSNEKLRAMFEELKSV
PETSVSTNNILLHSQDTFIFTIRNTSNSSRAIFNIVCKGQTLVREDGEEPDNHSRGTFGL
PRWLEVSPGAGIIKPDASLQVKVHHEDSHNSEEFIDGIQQNSLSEESSDKEVTLIIIVQG
SCSTRTISHSIKVRHCSSAAKSLSLVHSKTTTMTKNLEGSTRYQTDANRDRRSSRTVKPS
KEMHPVIVSSFSFLNSSDIRKGQIALRLFFRVQ

www.000webhost.com

Other information
Ka divergence:0.306655KaKs divergence:0.23863
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):3513Length 2 (bp):3522Length divergence:0.001
MFE 1 (kcal):-1149.54MFE 2 (kcal):-1156.22MFE divergence0.003