Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05640-AT2G31820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ankyrin repeat family protein
Function (paralog2):Ankyrin repeat family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.0457428556446
Log2 mRNA fold difference:5.3927184936269
Log2 TE fold difference:-2.1602637885731
Sequences
Protein sequence

MSSLVPVMEKQESVRGNSVEEQQSLRCVGAENQVRKGRALDKQVSFLAVNVVEKHGIKGR
AMEKQERAMERQRSFRGFVEKQKSFRVVMERQLSFMNVGGERKKKTDSPGKRGDSPLHLA
ARTGNLGKVMELIRACNGIEELKELSSKQNLEGETPLYSAAENGHSLVVEEMLKHMDLDT
ASVKARNGFDPFHVAAKQGHIEALKKLLETFPNLAMTVDLSCTTALHTAASQGHTDVVNL
LLKTDSHLAKIAKNNGKTALHSAARMGHREVVKSLIGNDASIGFRTDKKGQTALHMAVKG
QNEGIVLELVKPDPAILSVEDSKGNTPLHTATNKGRIKIVRCLVSFDGINLNAMNKAGDT
ALDIAEKIGNPELVSVLKEAGAATAKDLGKPRNPAKQLNQTVSDIKHEVQSQLQQSRQTG
VRVRRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQYEEDRTKGLLLLGE
ARIAGKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKNLVFVINKLMWLACLFIS
VAFVSLSFIVVGKEDIWLAICATIIGGTIMLTTIGAMCYCVVMHRIEESKLKSLRKERSK
SKSFSLSHMPSESEILNGEFNKRMYAL

MTIMEEKQNNSPVGEKQQSFNGIIINQTQENQTKSMEKQQSFRCVVENQPRKARALEKQV
SFQGVNVENYQQSRLGRSMEKQQSFRGVNVENHKRGVMEKLPSFGRATMERQKSFRGGFL
EKQKSFRVVMERQLSFIGERRKKNESPGKRGDSSLHIAARTGNLSKVKELIRGCGDELKE
LLSKQNLEGETPLYTAAENGHSIVVEEMLKHMDLETASIAARNGFDPFHVAAKQGHLEVL
KILLETFPNLAMTTDLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAA
RMGHVEVVKSLIGKDPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKG
NTPLHIATNKGRIKIVRCLVSFEGINLNPINKAGDTPLDVSEKIGNAELVSVLKEAGAAT
AKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINS
ATVVAVLIATVAFAAIFTIPGQYEEDRSKGELLGQAHIANKAPFLVFFIFDSLALFISLA
VVVVQTSVVVIEQKAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVI
GGTIMLTTIGAMCYCVVMHRMEESKLRSIRKERSKSQSFSMSRMPSDSDILNGEYNKRMY
AL

Other information
Ka divergence:-0.474075KaKs divergence:-0.158261
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1884Length 2 (bp):1989Length divergence:0.027
MFE 1 (kcal):-582.5MFE 2 (kcal):-603.92MFE divergence0.018