Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05650-AT1G05660
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.4278551852219
Log2 mRNA fold difference:1.8372949222495
Log2 TE fold difference:0.4772285968997
Sequences
Protein sequence

MTKSAITFPLIFTLLTFIDVSSSASIVFNVVSFGAKPDGVTDSTAAFLKAWQGACGSAAS
ATVVVPTGTFLLKVITFGGPCKSKITFQVTGTVVAPEDYRTFGNSGSWILFNKVNRFSLV
GGTFDARGSGFWSCRKSGQNCPPGVRSISFNSAKDVIISGVKSMNSQVSHMTLNGCTNVA
VRNIRLVAPGDSPNTDGFTVQFSTGVTLTGSTVQTGDDCVAIGQGTRNFLISKLACGPGH
GVSIGSLAKQLNEDGVENVTVSSSVFTGSQNGVRIKSWARPSTGFVRNVFFQNLIMRNVQ
NPIIIDQNYCPSNQGCPTEHSGVKITQVTYKNIQGTSATQEAMKLVCSKSNPCTGITLQD
IKLTYNKGTPATSLCFNAVGKNLGVIQPTSCLNR

MTKSVIRFSLLFTLLTFIDVSISASNVFNVVSFGAKPDGVTDSTGAFLKAWQGACVSASS
ATVVVPKGTFLLKVITFGGPCKSKITFQVAGTVIAPEDYRTFGNSGFWILFNKVNRFSLV
GGTFDARANGFWSCRKSGQNCPPGVRSISFNSAKDVIISGVKSMNSQVTHMTLNGCTNVV
VRNVKLVAPGNSPNTDGFHVQHSTGVTFTGSTVQTGDDCVAIGPGTRNLLITKLACGPGH
GVSIGSLAKELKEDGVENVTVSSSVFTGSQNGVRIKSWARPSNGFVRTVFFQDLVMKNVE
NPIIIDQNYCPTHEGCPNEYSGVKISQVTYKNIQGTSATQEAMKLVCSKSSPCTGITLQD
IKLTYNKGTPATSFCFNAVGKSLGVIQPTSCLNR

www.000webhost.com

Other information
Ka divergence:0.346899KaKs divergence:-0.0847248
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1185Length 2 (bp):1185Length divergence:0
MFE 1 (kcal):-379.8MFE 2 (kcal):-369.7MFE divergence-0.013