Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05710-AT2G31730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8725223176264
Log2 mRNA fold difference:-0.17109555805743
Log2 TE fold difference:2.0978686645014
Sequences
Protein sequence

MEFSRDAGMMMENKRNVCSLGESSIKRHKSDLSFSSKERKDKVGERISALQQIVSPYGKT
DTASVLLDAMHYIEFLHEQVKVCSSIPSMIHSSLSEFPCSFVQVLSAPYLQTVPDATQEE
LEQYSLRNRGLCLVPMENTVGVAQSNGADIWAPVKTPLSPAFSVTSQSPFR

MEYSRDSAEMMMETKRNVYSLEDNKIKRHKSSDLSFSSKERKDKLAERISALQQLVSPYG
KTDTASVLLEGMQYIQFLQEQVKVLSAPYLQATPSTTEEEVEEYSLRSKGLCLVPLEYTS
EVAQTNGADIWAPVKTPTSSHAFNLSSSNSPFQ

Other information
Ka divergence:0.489276KaKs divergence:-0.999634
GC content 1 (%):45GC content 2 (%):41GC content divergence:-0.047
Length 1 (bp):516Length 2 (bp):462Length divergence:-0.055
MFE 1 (kcal):-160.7MFE 2 (kcal):-124.62MFE divergence-0.126