Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05730-AT2G31725
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Eukaryotic protein of unknown function (DUF842)
Function (paralog2):Eukaryotic protein of unknown function (DUF842)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.012491619676
Log2 mRNA fold difference:2.3064353884729
Log2 TE fold difference:-1.0860011855949
Sequences
Protein sequence

MDHIAAAEEQIVTERIRRKLEEVNATAQSQLSPIQDHINFTLQQAYFKCAYECFDRNRKQ
EEIANCVEHCSVPVVNAQQHFEGEMSQFQERMNRSLMVCQDKFEAAKLHKNRGDAAKAME
SCVNTSIEDSLDTLPHIVQRMKTSFSIAD

MDHIAAAEEQIVSERLRRKLEEVNVAAQTQLSPIQDHINFTLQQAYFKCAYECFDRRRKQ
EEISNCVEHCSVPVVKSQQYFENEMAQFQERLNRSLVVCQDKFEASKLQKIRPEAVNEME
SCVHKSIEENLNTLPHIVQRMKTAFNITN

Other information
Ka divergence:-0.0312084KaKs divergence:0.175791
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):450Length 2 (bp):450Length divergence:0
MFE 1 (kcal):-136.52MFE 2 (kcal):-119.3MFE divergence-0.067