Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05760-AT1G05770
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Mannose-binding lectin superfamily protein
Function (paralog2):Mannose-binding lectin superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3715921920869
Log2 mRNA fold difference:-2.2531911541396
Log2 TE fold difference:1.2799030868025
Sequences
Protein sequence

MKIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHG
PFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDK
FAFKLGKSPQFGGFHGTYDASGLQYIGVYLRPKTVLPKIDTGNAEETESKIVLG

MEGKIKIGPVGTDYSGKKTMVDWDEGSHNGIISQIFLSHGPTGVFSIQFQFMLDDTFFLS
SCHGQNTGSMFDVILLNCPHEYITGISGEYLKSDGASGPQIRSLAFATNLNQYGPFGGSS
SQSSIWNHEQQFRFKLGKFRQFSGFYGTYNASGLQNIGVYLQPTIVKPTGTRNAEETESN
IVLG

Other information
Ka divergence:-0.231798KaKs divergence:-0.759797
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):525Length 2 (bp):555Length divergence:0.028
MFE 1 (kcal):-146.49MFE 2 (kcal):-136.82MFE divergence-0.034