Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05780-AT2G31710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Vacuolar ATPase assembly integral membrane protein VMA21-like domain
Function (paralog2):Vacuolar ATPase assembly integral membrane protein VMA21-like domain

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.8874301599477
Log2 mRNA fold difference:2.1360763493563
Log2 TE fold difference:-0.34164534527758
Sequences
Protein sequence

MAGVMHKFLIASMFMWILPVAILYGFNHNLLPGSTTLSPHSLILLSGFLAVVSVNTVIVF
YICMAMKEPADKHKPDAAFLAEAKDSVNKLTKGATSSDDHALKKQE

MAGVMQKFLIASMFMWILPIAILYGFNNDLLPGSTTLSPHSLTLLSGFLAVVSVNVVIVF
YICLALKEPADKHKPDASFVAEAKDSVKKLTSGVTNTDPALKKQE

www.000webhost.com

Other information
Ka divergence:0.40776KaKs divergence:0.184211
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):321Length 2 (bp):318Length divergence:-0.005
MFE 1 (kcal):-79MFE 2 (kcal):-83.39MFE divergence0.027