Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05810-AT2G31680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog A5E
Function (paralog2):RAB GTPase homolog A5D

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.23743481199384
Log2 mRNA fold difference:-1.31946386355
Log2 TE fold difference:1.5659048487597
Sequences
Protein sequence

MSSCASLLHRLPSPPLSLSLSLQTSPTSLSRNLGKKKKTVKRAMSSDDEGREEYLFKIVV
IGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAGQERFRAV
TSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLENIRAVSV
EEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDELTVNRVS
LVKDDNSASKQSSGFSCCSST

MSSDDEGGEEYLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKE
VKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVAR
MLVGNKCDLESIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNISRK
QLNSDTYKTELSMKNRVSLVKDDNKSSTQGFGFSCCSSS

Other information
Ka divergence:-0.103849KaKs divergence:0.999928
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):786Length 2 (bp):660Length divergence:-0.087
MFE 1 (kcal):-264MFE 2 (kcal):-187.7MFE divergence-0.169