Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05830-AT2G31650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):trithorax-like protein 2
Function (paralog2):homologue of trithorax

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.0940279580847
Log2 mRNA fold difference:-1.8789091783092
Log2 TE fold difference:-0.16078809874423
Sequences
Protein sequence

MISMSCVPKEEEGEDTQIKTELHDHAADNPVRYASLESVYSVSSSSSSLCCKTAAGSHKK
VNALKLPMSDSFELQPHRRPEIVHVYCRRKRRRRRRRESFLELAILQNEGVERDDRIVKI
ESAELDDEKEEENKKKKQKKRRIGNGELMKLGVDSTTLSVSATPPLRGCRIKAVCSGNKQ
DGSSRSKRNTVKNQEKVVTASATAKKWVRLSYDGVDPKHFIGLQCKVFWPLDAVWYPGSI
VGYNVETKHHIVKYGDGDGEELALRREKIKFLISRDDMELLNMKFGTNDVVVDGQDYDEL
VILAASFEECQDFEPRDIIWAKLTGHAMWPAIIVDESVIVKRKGLNNKISGGRSVLVQFF
GTHDFARIQVKQAVSFLKGLLSRSPLKCKQPRFEEAMEEAKMYLKEYKLPGRMDQLQKVA
DTDCSERINSGEEDSSNSGDDYTKDGEVWLRPTELGDCLHRIGDLQIINLGRIVTDSEFF
KDSKHTWPEGYTATRKFISLKDPNASAMYKMEVLRDAESKTRPVFRVTTNSGEQFKGDTP
SACWNKIYNRIKKIQIASDNPDVLGEGLHESGTDMFGFSNPEVDKLIQGLLQSRPPSKVS
QRKYSSGKYQDHPTGYRPVRVEWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHTRCYGQ
LEPHNGILWLCNLCRPVALDIPPRCCLCPVVGGAMKPTTDGRWAHLACAIWIPETCLLDV
KKMEPIDGVKKVSKDRWKLLCSICGVSYGACIQCSNNTCRVAYHPLCARAAGLCVELADE
DRLFLLSMDDDEADQCIRLLSFCKRHRQTSNYHLETEYMIKPAHNIAEYLPPPNPSGCAR
TEPYNYLGRRGRKEPEALAGASSKRLFVENQPYIVGGYSRHEFSTYERIYGSKMSQITTP
SNILSMAEKYTFMKETYRKRLAFGKSGIHGFGIFAKLPHRAGDMVIEYTGELVRPPIADK
REHLIYNSMVGAGTYMFRIDNERVIDATRTGSIAHLINHSCEPNCYSRVISVNGDEHIII
FAKRDVAKWEELTYDYRFFSIDERLACYCGFPRCRGVVNDTEAEERQANIHASRCELKEW
TES

MACFSNETQIEIDVHDLVEAPIRYDSIESIYSIPSSALCCVNAVGSHSLMSKKVKAQKLP
MIEQFEIEGSGVSASDDCCRSDDYKLRIQRPEIVRVYYRRRKRPLRECLLDQAVAVKTES
VELDEIDCFEEKKRRKIGNCELVKSGMESIGLRRCKENNAFSGNKQNGSSRRKGSSSKNQ
DKATLASRSAKKWVRLSYDGVDPTSFIGLQCKVFWPLDALWYEGSIVGYSAERKRYTVKY
RDGCDEDIVFDREMIKFLVSREEMELLHLKFCTSNVTVDGRDYDEMVVLAATLDECQDFE
PGDIVWAKLAGHAMWPAVIVDESIIGERKGLNNKVSGGGSLLVQFFGTHDFARIKVKQAI
SFIKGLLSPSHLKCKQPRFEEGMQEAKMYLKAHRLPERMSQLQKGADSVDSDMANSTEEG
NSGGDLLNDGEVWLRPTEHVDFRHIIGDLLIINLGKVVTDSQFFKDENHIWPEGYTAMRK
FTSLTDHSASALYKMEVLRDAETKTHPLFIVTADSGEQFKGPTPSACWNKIYNRIKKVQN
SDSPNILGEELNGSGTDMFGLSNPEVIKLVQDLSKSRPSSHVSMCKNSLGRHQNQPTGYR
PVRVDWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHAKCYGELEPCDGALWLCNLCRPG
APDMPPRCCLCPVVGGAMKPTTDGRWAHLACAIWIPETCLSDVKKMEPIDGVNKVSKDRW
KLMCTICGVSYGACIQCSNNSCRVAYHPLCARAAGLCVELENDMSVEGEEADQCIRMLSF
CKRHRQTSTACLGSEDRIKSATHKTSEYLPPPNPSGCARTEPYNCFGRRGRKEPEALAAA
SSKRLFVENQPYVIGGYSRLEFSTYKSIHGSKVSQMNTPSNILSMAEKYRYMRETYRKRL
AFGKSGIHGFGIFAKLPHRAGDMMIEYTGELVRPSIADKREQLIYNSMVGAGTYMFRIDD
ERVIDATRTGSIAHLINHSCVPNCYSRVITVNGDEHIIIFAKRHIPKWEELTYDYRFFSI
GERLSCSCGFPGCRGVVNDTEAEEQHAKICVPRCDLIDWTAE

Other information
Ka divergence:0.00977335KaKs divergence:-0.126356
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3252Length 2 (bp):3189Length divergence:-0.01
MFE 1 (kcal):-997.79MFE 2 (kcal):-985.36MFE divergence-0.006