Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05860-AT2G31600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.19916930817913
Log2 mRNA fold difference:-1.7154759283535
Log2 TE fold difference:1.3381933136015
Sequences
Protein sequence

MASASKQNPSSSKPPRHPSPIIASTPSKSGVLEESQFRNPNNPSTSSNSPISMAVEDQIL
GNSNHLTRPELLRRRSHNLKQLSRCYRDHYWALMEDLKAQHRYYSWNYGVSPFKDENYHQ
NKRRKVEGQTGDEIEGSGDNDNNNNDGVKAGNCVACGSGCKSKAMALTNYCQLHILMDKK
QKLYTSCTYVNKRAQSKAITCPKPTLASTVPALCNVHFQKAQKDVARALKDAGHNVSSAS
RPPPKLHDIVAAFVHHIQAKRKDPRKEGKLKSLVKEELTS

MASASKNIQQNPFSSKPPRPPYSSGAASTTAVASTSAEPLIRNSTLNPNPSTSGLPSTSN
SPITMSQEDEILARSSHITRSELLKRRSHNLKQLAKCYRDNYWALMEDVKAQHRDYWWKY
GISQFKDENNQSNKRRRLGQEGDIGDGGDAVEGSGDNVTNNDGVKSDQYANSNCGSCMYG
CKAKAMALTKYCQLHILKDSKQKLYTGCTNVIKRAPAGPLLCGKPTLASTVPALCNIHFQ
KAQKHVAKALKDAGHNVSSTSKPPPKLHVIVAAFVHHIQAKRKNPQKECKLKSVVKEENT
S

Other information
Ka divergence:-0.061055KaKs divergence:-0.0657124
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):843Length 2 (bp):906Length divergence:0.036
MFE 1 (kcal):-237MFE 2 (kcal):-246.55MFE divergence0.02