Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05870-AT2G31560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1685)
Function (paralog2):Protein of unknown function (DUF1685)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4312501398777
Log2 mRNA fold difference:-0.04727384394426
Log2 TE fold difference:1.3207391634276
Sequences
Protein sequence

MGCVRCKSSDPWQTSANAFESVDESGINEAWVEISSRRSFVAGEGSRKKLERKKSQVLLE
GYVETASSSSVDDQKDDLTRSKSLTDDDLEDLRGCLDLGFGFSYDEIPELCNTLPALELC
YSMSQKFLDDKQNKSPETSSVEDCPSPPLVTATPIANWKISSPGDNPDDVKARLKYWAQA
VACTVQLCS

MACIHIESSHPPAWKTHSVQENKPANADDISNTTLPEHHDGGDGGIQETWAAIGDSGGRG
GGYFAGESRKKLEKKKSQVLLEGYALDDQDDLTRAKSLTDDDLEELKGCLDLGFGFSYDE
IPELCNTLPALELCYSMSQKFLDDKQQNHHKSQEEDDSSPPPTTTAPIANWKISSPGDDP
DDVKARLKYWAQTVACTVRLCS

Other information
Ka divergence:0.191209KaKs divergence:0.695106
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):570Length 2 (bp):609Length divergence:0.033
MFE 1 (kcal):-196.21MFE 2 (kcal):-177.4MFE divergence-0.05