Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05890-AT2G31510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):IBR domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.82945199734071
Log2 mRNA fold difference:0.33140262487813
Log2 TE fold difference:0.53219137963374
Sequences
Protein sequence

MDSDDDMHDMDSVDYDYYSGGTYDDNDSDETDFGFGEADTDDAAIIASYRSKVASILVSC
FGLLLQRWRMLEAVFCLFVCFFFFGLRLLLYSCNSNYVVLKEEDIRRHQNDDVGRVSAVL
SITDVEASTLLLHYHWSVSKVNDEWFADEERVRRTVGILEGPVVTTPDGREFTCGICFDS
YTLEEIVSVSCGHPFCATCWTGYISTTINDGPGCLMLKCPDPSCPAAIGRDMIDKLASKE
DKEKYYRYFLRSYVEVNREMKWCPAPGCEHAIDFAGGTESYDVSCLCSHSFCWNCTEEAH
RPVDCDTVGKWILKNSAESENMNWILANSKPCPKCKRPIEKNHGCMHMTCTPPCKFEFCW
LCLNAWTEHGERTGGFYACNRYEAAKQEGLYDEAERRREMAKNSLERYTHYYERWASNQV
SRQKAMGDLQKMQSEKLGKLSDIQCTPESQLKFIAEAWLQIIECRRVLKWTYAYGYYLQD
HAKKPFFEYLQGEAESGLERLHKCVEKDIEVFELAEGPSEEFNHFRTKLTGLTSITKTFF
ENLVKALENGLADVDSQAASSKPANSKPSSKTKGGGKGKGSSKNGGSSRNPDGN

MDSEEDMLDAHDMESGEDDFYSGGTDDCNDSDDGEPDYGFVEEDADDSAMIASHRSQKNF
CVLREEDIRRHQMDNIERVSVVLSITEVEASILLRHFHWSVGRVHDEWFADEERVRKTVG
ILESHVVPPSDDSELTCGICFDSYPPEKIASVSCGHPFCTTCWTGYISTTINDGPGCLML
RCPDPSCLAAVGHDMVDKLASEDEKEKYNRYFLRSYIEDNRKMKWCPAPGCDFAIDFVAG
SGNYDVSCLCSFSFCWNCTEEAHRPVDCSTVSKWILKNSAESENMNWILANSKPCPRCKR
PIEKNQGCMHMTCTPPCKYEFCWLCLGAWMDHGERTGGFYACNRYEVAKQEGQYDETERR
REMAKNSLERYTHYYERWASNQTSRQKAMADLQQAQMQNLEKLSDKQCTPESQLKFILEA
WLQIIECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCVEKDLVQFLIA
EGPSKDFNDFRTKLAGLTSVTKNYFENLVKALENGLADVDSHAACSSKSTSSKSTGCSSK
TRGKGKGSSRTGGSSRNPDDNL

www.000webhost.com

Other information
Ka divergence:-0.282554KaKs divergence:-0.246747
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1785Length 2 (bp):1689Length divergence:-0.028
MFE 1 (kcal):-531.76MFE 2 (kcal):-517.99MFE divergence-0.013