Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G05900-AT2G31450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):endonuclease III 2
Function (paralog2):DNA glycosylase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.51612913367286
Log2 mRNA fold difference:-0.4024439963499
Log2 TE fold difference:-0.12948823575153
Sequences
Protein sequence

MILTGAASTFPIVARVLNAMNRRMYAATTLSSAKSISAESLNLRSDSNSEAAHGASESET
RVSLRKKRIKQDDLEPVKKCSARETKARKDMCGLPDIEDSPYKKTNGTASSRTRKLNSYI
KSTEASPSASSIKTAGLGIPPENWEKVLEGIRKMKPSEEAPVNAVECDRTGSFLPPKERR
FYVLIGTLLSSQTKEHITGAAVERLHQNGLLTPEAIDKADESTIKELIYPVGFYTRKATN
VKKVAKICLMEYDGDIPRTLEELLSLPGVGPKIAHLVLHVAWNDVQGICVDTHVHRICNR
LGWVSKPGTKQKTSSPEETRVALQQWLPKGEWVAINFLLVGFGQTICTPLRPHCGTCSIT
EICPSAFKETPSTSSKLKKSIKSKKL

MILLVNGGAATSIHPNAARFYRIGTMSRQIHGAVSSSKHISLKTQHPLSDSNSELAYGAS
GSETRVYTRKKRLKQEPFEPLEKYSGKGVNTHKLCGLPDIEDFAYKKTIGSPSSSRSTET
SITVTSVKTAGYPPENWVEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERRFAVLLGA
LLSSQTKDQVNNAAIHRLHQNGLLTPEAVDKADESTIKELIYPVGFYTRKATYMKKIARI
CLVKYDGDIPSSLDDLLSLPGIGPKMAHLILHIAWNDVQGICVDTHVHRICNRLGWVSRP
GTKQKTTSPEETRVALQQWLPKEEWVAINPLLVGFGQMICTPIRPRCEACSVSKLCPAAF
KETSSPSSKLKKSNRSKEP

www.000webhost.com

Other information
Ka divergence:-0.443763KaKs divergence:0.0799079
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1161Length 2 (bp):1140Length divergence:-0.009
MFE 1 (kcal):-332.7MFE 2 (kcal):-330.67MFE divergence-0.003