Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06020-AT1G06030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):pfkB-like carbohydrate kinase family protein
Function (paralog2):pfkB-like carbohydrate kinase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.7158731905319
Log2 mRNA fold difference:2.6587203885513
Log2 TE fold difference:-0.11842081792083
Sequences
Protein sequence

MASSTGEKGLIVSFGEMLIDFVPTVSGVSLSESPGFLKAPGGAPANVAIAVSRLGGRAAF
VGKLGDDDFGHMLAGILRKNGVDDQGINFDEGARTALAFVTLRSDGEREFMFYRNPSADM
LLRPDELNLELIRSAKVFHYGSISLITEPCRSAHMKAMEVAKEAGALLSYDPNLREPLWP
SPEEARTQIMSIWDKADIIKVSDVELEFLTENKTMDDKTAMSLWHPNLKLLLVTLGEKGC
TYFTKKFHGSVETFHVDAVDTTGAGDSFVGALLQQIVDDQSVLEDEARLRKVLRFANACG
AITTTKKGAIPALPTDIEALSFLKDQKKRQTNLKFSKWCCTASPC

MTSSNGDNKGLVVSFGEMLIDFVPTESGVSLSESSGFLKAPGGAPANVAIAVSRLGGRAA
FVGKLGDDEFGHMLAGILRKNDVDDQGINFDKGARTALAFVTLRSDGEREFMFYRNPSAD
MLLRPDELNLELIRSAKVFHYGSISLITEPCRSAHMKAMEVAKEAGALLSYDPNLREPLW
PSPEEARKQIMSIWDKADIIKVSDVELEFLTGNKTIDDETAMSLWHPNLKLLLVTLGENG
CRYYTKDFHGSVETFHVDAVDTTGAGDSFVGALLNQIVDDQSVLEEEERLRKVLRFANAC
GAITTTKKGAIPALPTDCEALSFLKIQVE

www.000webhost.com

Other information
Ka divergence:-0.102971KaKs divergence:0.25851
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1038Length 2 (bp):990Length divergence:-0.024
MFE 1 (kcal):-336.33MFE 2 (kcal):-315.6MFE divergence-0.032