Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06040-AT2G31380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-box zinc finger family protein
Function (paralog2):salt tolerance homologue

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.7672335306938
Log2 mRNA fold difference:-1.1992220204566
Log2 TE fold difference:-0.60871035018277
Sequences
Protein sequence

MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDIC
QEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQP
EPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELD
WFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKPMKSNVSHKKPRFETRYDDDDEE
HFIVPDLG

MKIQCDVCEKAPATLICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDIC
LEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHF
DPSNQQSLSKPPTQQPAAPSPLWATDEFFSYSDLDCSNKEKEQLDLGELDWLAEMGLFGD
QPDQEALPVAEVPELSFSHLAHAHSYNRPMKSNVPNKKQRLEYRYDDEEEHFLVPDLG

Other information
Ka divergence:0.221894KaKs divergence:0.123499
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):747Length 2 (bp):717Length divergence:-0.02
MFE 1 (kcal):-213.45MFE 2 (kcal):-215.2MFE divergence0.004