Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06070-AT2G31370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Basic-leucine zipper (bZIP) transcription factor family protein
Function (paralog2):Basic-leucine zipper (bZIP) transcription factor family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.0404147779361
Log2 mRNA fold difference:1.2990609239082
Log2 TE fold difference:0.73841539636044
Sequences
Protein sequence

MDKEKSPAPPPSGGLPPPSGRYSAFSPNGSSFAMKAESSFPPLTPSGSNSSDANRFSHDI
SRMPDNPPKNLGHRRAHSEILTLPDDLSFDSDLGVVGAADGPSFSDDTDEDLLYMYLDME
KFNSSATSTSQMGEPSEPTWRNELASTSNLQSTPGSSSERPRIRHQHSQSMDGSTTIKPE
MLMSGNEDVSGVDSKKAISAAKLSELALIDPKRAKRIWANRQSAARSKERKMRYIAELER
KVQTLQTEATSLSAQLTLLQRDTNGLGVENNELKLRVQTMEQQVHLQDALNDALKEEVQH
LKVLTGQGPSNGTSMNYGSFGSNQQFYPNNQSMHTILAAQQLQQLQIQSQKQQQQQQQHQ
QQQQQQQQQFHFQQQQLYQLQQQQRLQQQEQQSGASELRRPMPSPGQKESVTSPDRETPL
TKD

MDKEKSPAPPCGGLPPPSPSGRCSAFSEAGPIGHGSDANRMSHDISRMLDNPPKKIGHRR
AHSEILTLPDDLSFDSDLGVVGNAADGASFSDETEEDLLSMYLDMDKFNSSATSSAQVGE
PSGTAWKNETMMQTGTGSTSNPQNTVNSLGERPRIRHQHSQSMDGSMNINEMLMSGNEDD
SAIDAKKSMSATKLAELALIDPKRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEA
TTLSAQLTLLQRDTNGLTVENNELKLRLQTMEQQVHLQDELNEALKEEIQHLKVLTGQVA
PSALNYGSFGSNQQQFYSNNQSMQTILAAKQFQQLQIHSQKQQQQQQQQQQQHQQQQQQQ
QQYQFQQQQMQQLMQQRLQQQEQQNGVRLKPSQAQKEN

Other information
Ka divergence:0.314056KaKs divergence:0.021913
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1272Length 2 (bp):1197Length divergence:-0.03
MFE 1 (kcal):-363.82MFE 2 (kcal):-340.4MFE divergence-0.033