Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06130-AT2G31350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glyoxalase 2-4
Function (paralog2):glyoxalase 2-5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.72447108305939
Log2 mRNA fold difference:0.38000057378252
Log2 TE fold difference:-0.99716927540082
Sequences
Protein sequence

MQAISKVSSAASFFRCSRKLVSQPCVRPCVRQLHVRKGLVSGVMKLFSSPLRTLRDAGKS
VRISRFCSVSNVSSSLQIELVPCLTDNYAYILHDEDTGTVGVVDPSEAVPVMDALQKNSR
NLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAADRDRIPGIDVALKDADKWMFAGHEVH
IMETPGHTRGHISFYFPGARAIFTGDTLFSLSCGKLFEGTPEQMLASLQRIIALPDDTSV
YCGHEYTLSNSKFALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKMEKACNPFLRTEN
TDIRRALGIPETADEAEALGIIRRAKDNFKA

MQTISKASSATSFFRCSRKLSSQPCVRQLNIRKSLVCRVMKLVSSPLRTLRGAGKSIRVS
KFCSVSNVSSLQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYI
LNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTP
GHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHE
YTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRR
ALRIPEAADEAEALGIIRKAKDDF

Other information
Ka divergence:-0.0851207KaKs divergence:-0.0683498
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):996Length 2 (bp):975Length divergence:-0.011
MFE 1 (kcal):-287.2MFE 2 (kcal):-290.89MFE divergence0.006