Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06150-AT2G31280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):conserved peptide upstream open reading frame 7

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.9411069292014
Log2 mRNA fold difference:-0.15631785341434
Log2 TE fold difference:-1.8129804159951
Sequences
Protein sequence

MGYTLQQILRSICSNTDWNYAVFWKLNHHSPMVLTLEDVYCVNHERGLMPESLHGGRHAH
DPLGLAVAKMSYHVHSLGEGIVGQVAISGQHQWIFSEYLNDSHSTLQVHNGWESQISAGI
KTILIVAVGSCGVVQLGSLCKVEEDPALVTHIRHLFLALTDPLADHASNLMQCDINSPSD
RPKIPSKCLHEASPDFSGEFDKAMDMEGLNIVSQNTSNRSNDLPYNFTPTYFHMERTAQV
IGGLEAVQPSMFGSNDCVTSGFSVGVVDTKHKNQVDISDMSKVIYDEETGGYRYSRELDP
NFQHYSRNHVRNSGGTSALAMESDRLKAGSSYPQLDSTVLTALKTDKDYSRRNEVFQPSE
SQGSIFVKDTEHRQEEKSESSQLDALTASLCSFSGSELLEALGPAFSKTSTDYGELAKFE
SAAAIRRTNDMSHSHLTFESSSENLLDAVVASMSNGDGNVRREISSSRSTQSLLTTAEMA
QAEPFGHNKQNIVSTVDSVISQPPLADGLIQQNPSNICGAFSSIGFSSTCLSSSSDQFPT
SLEIPKKNKKRAKPGESSRPRPRDRQLIQDRIKELRELVPNGSKCSIDSLLECTIKHMLF
LQSVSQHADKLTKSASSKMQHKDTGTLGISSTEQGSSWAVEIGGHLQVCSIMVENLDKEG
VMLIEMLCEECSHFLEIANVIRSLELIILRGTTEKQGEKTWICFVVEGQNNKVMHRMDIL
WSLVQIFQPKATNSLHLYRQSQILYMNAFANVHSLRVPSHHLRDFSASLSLAPPNLKKII
KQCSTPKLLESALAAMIKTSLNQDCRLMNQFITACTSFKRLDLAVSTMTQMQEPNVFVYN
ALFKGFVTCSHPIRSLELYVRMLRDSVSPSSYTYSSLVKASSFASRFGESLQAHIWKFGF
GFHVKIQTTLIDFYSATGRIREARKVFDEMPERDDIAWTTMVSAYRRVLDMDSANSLANQ
MSEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVF
YKMMEEGIIPDEVTMSTVISACAHLGVLEIGKEVHMYTLQNGFVLDVYIGSALVDMYSKC
GSLERALLVFFNLPKKNLFCWNSIIEGLAAHGFAQEALKMFAKMEMESVKPNAVTFVSVF
TACTHAGLVDEGRRIYRSMIDDYSIVSNVEHYGGMVHLFSKAGLIYEALELIGNMEFEPN
AVIWGALLDGCRIHKNLVIAEIAFNKLMVLEPMNSGYYFLLVSMYAEQNRWRDVAEIRGR
MRELGIEKICPGTSSIRIDKRDHLFAAADKSHSASDEVCLLLDEIYDQMGLAGYVQETEN
VY

MGSTSQEILKSFCFNTDWDYAVFWQLNHRGSRMVLTLEDAYYDHHGTNMHGAHDPLGLAV
AKMSYHVYSLGEGIVGQVAVSGEHQWVFPENYNNCNSAFEFHNVWESQISAGIKTILVVA
VGPCGVVQLGSLCKVNEDVNFVNHIRHLFLALRDPLADHAANLRQCNMNNSLCLPKMPSE
GLHAEAFPDCSGEVDKAMDVEESNILTQYKTRRSDSMPYNTPSSCLVMEKAAQVVGGREV
VQGSTCGSYSGVTFGFPVDLVGAKHENQVGTNIIRDAPHVGMTSGCKDSRDLDPNLHLYM
KNHVLNDTSTSALAIEAERLITSQSYPRLDSTFQATSRTDKESSYHNEVFQLSENQGNKY
IKETERMLGRNCESSQFDALISSGYTFAGSELLEALGSAFKQTNTGQEELLKSEHGSTMR
PTDDMSHSQLTFDPGPENLLDAVVANVCQRDGNARDDMMSSRSVQSLLTNMELAEPSGQK
KHNIVNPINSAMNQPPMAEVDTQQNSSDICGAFSSIGFSSTYPSSSSDQFQTSLDIPKKN
KKRAKPGESSRPRPRDRQLIQDRIKELRELVPNGSKCSIDSLLERTIKHMLFLQNVTKHA
EKLSKSANEKMQQKETGMQGSSCAVEVGGHLQVSSIIVENLNKQGMVLIEMLCEECGHFL
EIANVIRSLDLVILRGFTETQGEKTWICFVTEVGSRITQFMKEIPKQIKSQNSKVMQRMD
ILWSLVQIFQPKANEKG

www.000webhost.com

Other information
Ka divergence:-0.0303504KaKs divergence:-0.145788
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):3969Length 2 (bp):2214Length divergence:-0.284
MFE 1 (kcal):-1195.91MFE 2 (kcal):-642.64MFE divergence-0.301