Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06180-AT2G31180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 13
Function (paralog2):myb domain protein 14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.43806817105975
Log2 mRNA fold difference:-1.4229557572769
Log2 TE fold difference:2.5157534688811
Sequences
Protein sequence

MGRRPCCEKIGLKKGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINY
LRPDIKRGNFTPHEEDTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQ
DQNNKEDFVSTTAAEMPTSPQQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAII
DESFWSEVVLMDCDISGNEKNEKKIENWEGSLDRNDKGYNHDMEFWFDHLTSSSCIIGEM
SDISEF

MGRAPCCEKMGVKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINY
LRPDIKRGNFTPQEEQTIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLSKNL
NNGGDTKDVNGINETTNEDKGSVIVDTASLQQFSNSITTFDISNDNKDDIMSYEDISALI
DDSFWSDVISVDNSNKNEKKIEDWEGLIDRNSKKCSYSNSKLYNDDMEFWFDVFTSNRRI
EEFSDIPEF

Other information
Ka divergence:-0.123889KaKs divergence:-0.56191
GC content 1 (%):41GC content 2 (%):37GC content divergence:-0.051
Length 1 (bp):741Length 2 (bp):750Length divergence:0.006
MFE 1 (kcal):-198.02MFE 2 (kcal):-179.74MFE divergence-0.048