Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06200-AT2G31140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidase S24/S26A/S26B/S26C family protein
Function (paralog2):Peptidase S24/S26A/S26B/S26C family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.22768490718366
Log2 mRNA fold difference:-0.83198203849271
Log2 TE fold difference:0.55199584149763
Sequences
Protein sequence

MASITNYVRYMAHKLEYSLTLSLKKHTREKLSDRELFGVVMKNLFYGRISYLHSDKGKEM
APTMGTNESTLLVRKLPVVDTRYIFVGDAVVLKDPNETNKYIVRRLAALEGSEMVSSDEK
DEPFVLEKDQCWVVAENQEMKSKEAYDSRTFGPISMADIVGRAIYCLRTAVDHGPVSNSE
FAMDEDSPILAVELDVDELAKGHKAS

MASISTWFRYMAHKLEYSLTLSLKSHRSNKLSDRELIQIICKNLFYGKITYLHSDKGPEM
SPTMTANENTLLIRKIPIANTRFVFIGDAVVLKDPNDSDKYLVRRLAAVEGFEMVSGDEK
EEPFVLEKNQCWVTAENQELKAKEAYDSRTFGPVSTADIVGRAIYCLRTAVDHGPVRNSQ
TAMGQDSPILAVELDVDEMAKNHKA

Other information
Ka divergence:-0.387257KaKs divergence:-0.52155
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):621Length 2 (bp):618Length divergence:-0.002
MFE 1 (kcal):-170.8MFE 2 (kcal):-169.12MFE divergence-0.005